KEGG   Streptococcus macedonicus: SMA_0455Help
Entry
SMA_0455          CDS       T01674                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
smn  Streptococcus macedonicus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:smn00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
466106..466723
Genome map
AA seq 205 aa AA seqDB search
MTERGLLIVFSGPSGVGKGTVRQEIFSTPDHKFEYSISMTTRQKRPEEVDGVDYFFRTRE
EFEELIKNGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIEVQGALQVKKKVPDGVF
IFLTPPDLDELKDRLVGRGTDSEEVIRQRIERAKEEITLMREYDYVVVNDEVSLAAERVK
RIIEVEHLRVDRVIGQYNDMIKDID
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacgtggtttgttaattgttttctcaggaccttctggggttggtaagggaaca
gttcgccaagaaattttttcaacaccagatcataaatttgaatattccatttctatgaca
acacgccaaaaacggccagaagaagtcgatggcgttgattatttcttccgaactcgtgaa
gaatttgaggagcttattaaaaatggtcaaatgttggaatatgctgaatacgtaggaaac
tactatggcacaccactgacttatgttaatgaaactcttgataaggggattgacgtattc
cttgaaatcgaagtgcaaggagcgcttcaagttaagaagaaagttccagatggggtgttt
attttcttaacgccacctgatttggacgaattaaaagatcgtttggtaggacgtggtaca
gatagcgaggaagttatccgccaacgtatcgaacgtgctaaagaagaaatcactttgatg
cgtgagtatgattatgttgttgttaacgatgaagtatctttggcagctgaacgcgttaaa
cgcattatcgaagtagaacatctccgtgttgatcgtgttatcggacaatataacgacatg
attaaagatattgattaa

DBGET integrated database retrieval system