KEGG   Streptococcus macedonicus: SMA_0540Help
Entry
SMA_0540          CDS       T01674                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
smn  Streptococcus macedonicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SMA_0540 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMA_0540 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SMA_0540 (trpB)
Enzymes [BR:smn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SMA_0540 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
546977..548179
Genome map
AA seq 400 aa AA seqDB search
MSYNQPDTNGFYGKFGGQFVPETLMTAVIELNKAYREAEADPSFQEELDALLKNYVGRET
PLYYAERLTKHIGGAKIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKIIAETGAGQHG
VATATAAALFDMECTIYMGEEDVKRQALNVFRMELLGAKVFSVTDGSRVLKDAVNAALRA
WVANIEDTHYIMGSALGPAPFPEMVRDFQSVIGQEAKKQYAEISGGKLPDAVLACVGGGS
NAIGLFYPFVEDESVALYGAEAAGHGLDTEEHAATFAKGRIGILHGALMNVLQDRHGQIM
EAFSISAGLDYPGVGPEHCHFKDIGRATYDSITDDEALEAFMLLSRLEGIIPALESSHAI
ALTQKVAKELGPDKSIIVCLSGRGDKDVVQVKERLEAEGK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagctataaccaaccagatactaatggattttacggaaaatttggtggacaatttgtt
cccgaaacactgatgactgcggttatcgaacttaataaagcttaccgcgaagctgaggca
gacccaagctttcaagaagaactcgatgcgcttttgaaaaattatgtcggtcgtgaaaca
ccgctttattacgcagagcgtttaacaaaacatatcggcggtgcgaaaatttacctcaaa
cgtgaagacctaaaccacacaggtgctcataaaattaacaatgccctcggtcaagttctt
cttgctaaacgaatgggtaaaaagaaaattattgctgaaactggtgctggtcaacacggg
gttgcaacagcaacagcagctgcactttttgacatggaatgtacgatttacatgggtgaa
gaggacgtaaaacgccaagcactaaatgtttttcgtatggaattgctaggcgctaaagtc
ttttctgtaactgatggttcacgcgttttgaaagatgccgtaaatgcagcccttcgcgca
tgggtagctaatatcgaagatacacactacatcatggggtcagctctcggacctgcacct
ttccctgaaatggttcgtgacttccaatctgttatcggtcaagaagcaaagaaacaatat
gcagagatttcaggaggaaaattgcctgatgctgtcctagcctgtgttggcggtggttca
aatgcgattggtcttttctatccatttgtcgaagatgaatcagttgctctttacggtgct
gaagcagcaggacatggacttgatactgaagagcacgctgcaacatttgccaaaggacgc
ataggtattttgcatggcgctttgatgaatgttttgcaagaccgccatgggcaaatcatg
gaagctttctcaatttcagcgggtcttgattatccaggcgttggtccagagcattgtcat
tttaaagatatcggtcgtgccacatatgattctattactgatgatgaagcacttgaagca
tttatgctcctatcacgtttggaagggattattcctgcgcttgaatcaagccatgccatt
gctttgactcaaaaagtggctaaagaattaggtccagataaatcaatcattgtttgtcta
tctggacgtggcgataaagatgttgtgcaagtaaaagaacgtttggaagcagaagggaaa
tag

DBGET integrated database retrieval system