KEGG   Streptococcus macedonicus: SMA_0541Help
Entry
SMA_0541          CDS       T01674                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
smn  Streptococcus macedonicus
Pathway
smn00260  Glycine, serine and threonine metabolism
smn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smn01100  Metabolic pathways
smn01110  Biosynthesis of secondary metabolites
smn01130  Biosynthesis of antibiotics
smn01230  Biosynthesis of amino acids
Module
smn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMA_0541 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SMA_0541 (trpA)
Enzymes [BR:smn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SMA_0541 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA
Motif
Other DBs
NCBI-ProteinID: CCF01832
UniProt: H2A558
Position
548183..548965
Genome map
AA seq 260 aa AA seqDB search
MTKTLTKHLENIATSGKGIFVPYIMAGDHEKALDSLFDTITFLENSGASAIEVGIPWSDP
VADGPVIELAGQRSLANGVNLTAIVQKLQEKQTTIPLVIMTYINPVYQYGIEKFIADLKN
TSVKGLIIPDLPHEHENMVKPYLTDTDIALVPLVSLTTGIERQKTLCKDAEGFIYAVAIN
GVTGKTGNYRDDLDKHLTNLKTIADIPVLTGFGVSTPADIERFNKVSDGVIVGTKIVRGL
HEGKTDDVADFVKYGSNYQK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgactaagacactcacaaaacatcttgaaaacattgcaacaagcggtaaaggaattttt
gtgccatacattatggcaggagaccacgaaaaagctttagacagtttgtttgacaccatt
acttttttggaaaatagcggagcttctgctattgaagtaggcattccatggtcagacccc
gttgctgatggaccagtcattgaattggcagggcaaagaagcttggctaatggtgtgaat
ttgacagcgattgttcaaaaattacaagaaaaacaaacgacaattcctttggtcatcatg
acttacatcaatcctgtctatcaatacggcattgagaaatttattgctgacttgaaaaat
acgtctgttaaagggttgattattcctgatttaccacacgaacacgagaatatggtaaaa
ccatatcttaccgacacagatattgcgcttgtgccactcgttagtctgacaacaggtatt
gaacgtcaaaaaacgttatgtaaagatgctgaaggatttatctatgccgttgctattaat
ggtgttactggtaaaactggtaattatcgtgatgatttggataaacatttgaccaatctt
aaaaccattgctgacattcctgttttaacaggttttggtgtctcaactccagcggacatt
gagcgatttaacaaagtatcagacggtgttattgtcggaacaaaaattgttagaggctta
cacgaaggaaaaacagatgatgttgctgacttcgtcaaatacggctcaaattatcaaaaa
taa

DBGET integrated database retrieval system