KEGG   Streptococcus macedonicus: SMA_0541Help
Entry
SMA_0541          CDS       T01674                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
smn  Streptococcus macedonicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SMA_0541 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMA_0541 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SMA_0541 (trpA)
Enzymes [BR:smn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SMA_0541 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
548183..548965
Genome map
AA seq 260 aa AA seqDB search
MTKTLTKHLENIATSGKGIFVPYIMAGDHEKALDSLFDTITFLENSGASAIEVGIPWSDP
VADGPVIELAGQRSLANGVNLTAIVQKLQEKQTTIPLVIMTYINPVYQYGIEKFIADLKN
TSVKGLIIPDLPHEHENMVKPYLTDTDIALVPLVSLTTGIERQKTLCKDAEGFIYAVAIN
GVTGKTGNYRDDLDKHLTNLKTIADIPVLTGFGVSTPADIERFNKVSDGVIVGTKIVRGL
HEGKTDDVADFVKYGSNYQK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgactaagacactcacaaaacatcttgaaaacattgcaacaagcggtaaaggaattttt
gtgccatacattatggcaggagaccacgaaaaagctttagacagtttgtttgacaccatt
acttttttggaaaatagcggagcttctgctattgaagtaggcattccatggtcagacccc
gttgctgatggaccagtcattgaattggcagggcaaagaagcttggctaatggtgtgaat
ttgacagcgattgttcaaaaattacaagaaaaacaaacgacaattcctttggtcatcatg
acttacatcaatcctgtctatcaatacggcattgagaaatttattgctgacttgaaaaat
acgtctgttaaagggttgattattcctgatttaccacacgaacacgagaatatggtaaaa
ccatatcttaccgacacagatattgcgcttgtgccactcgttagtctgacaacaggtatt
gaacgtcaaaaaacgttatgtaaagatgctgaaggatttatctatgccgttgctattaat
ggtgttactggtaaaactggtaattatcgtgatgatttggataaacatttgaccaatctt
aaaaccattgctgacattcctgttttaacaggttttggtgtctcaactccagcggacatt
gagcgatttaacaaagtatcagacggtgttattgtcggaacaaaaattgttagaggctta
cacgaaggaaaaacagatgatgttgctgacttcgtcaaatacggctcaaattatcaaaaa
taa

DBGET integrated database retrieval system