KEGG   Streptococcus macedonicus: SMA_0546Help
Entry
SMA_0546          CDS       T01674                                 

Gene name
glcK
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
smn  Streptococcus macedonicus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMA_0546 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMA_0546 (glcK)
   00052 Galactose metabolism
    SMA_0546 (glcK)
   00500 Starch and sucrose metabolism
    SMA_0546 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    SMA_0546 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SMA_0546 (glcK)
   00524 Butirosin and neomycin biosynthesis
    SMA_0546 (glcK)
Enzymes [BR:smn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SMA_0546 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
552141..553109
Genome map
AA seq 322 aa AA seqDB search
MTKKLLGIDLGGTTIKFGILTLEGEVQEKWAIDTNILEDGKHIVPDIVESIKHRLNLYGL
TKDDFVGIGMGSPGAVDRAKKTVTGAFNLNWAHTEEVGSVIERELGIPFAIDNDANVAAL
GERWRGAGANNPDVVFVTLGTGVGGGVIADGNLIHGVAGAGGEIGHMNVEPVDGFKCTCG
NKGCLETVASATGVVRVARHLAEEYEGDSSIKAAIDNGDVVTSKDIFVAAEAGDHFADSV
VEKVGFYLGQATANIANILNPDSVVIGGGVSAAGEFLRSRVEKYFVSYAFPQVRKTTKIK
IAELGNDAGIIGAASLASQFVD
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaacttttagggattgaccttggtgggacaacgattaaattcggtatccta
acacttgagggagaagtgcaagaaaaatgggcaattgatacgaatatacttgaagatggt
aaacacattgtccctgatattgttgaatcaattaaacaccgtttgaatctttacggtttg
acaaaagatgattttgtaggtatcggtatggggtctccaggtgctgttgaccgcgctaaa
aaaacagttacaggtgctttcaacttgaactgggcacacactgaagaagtcggttcagtt
atcgaacgtgaacttgggattccatttgctattgataacgatgcaaacgtagctgcactt
ggtgaacgttggagaggtgctggcgcaaataatccagatgttgtttttgtaacacttgga
actggtgttggtggcggtgttatcgctgacggtaaccttatccacggtgtcgctggtgct
ggtggagaaattggtcacatgaatgttgaaccagttgatggatttaaatgtacttgtggt
aacaaaggttgtctagaaacagttgcttcagcaacaggtgttgtgcgtgtggctcgtcat
ttggctgaagaatacgaaggtgattcaagcatcaaagctgccattgacaatggtgatgtg
gtgacaagtaaagacatctttgtcgctgctgaagcgggtgaccattttgccgattcagtt
gttgaaaaagttggtttctatcttggtcaagcaacagcaaatatcgcaaacatcttgaac
ccagattcagttgttatcggtggtggtgtttcagctgcaggtgaattcttgcgtagtcgc
gttgaaaaatattttgtcagctacgctttcccacaagtgcgcaaaacaacaaaaattaaa
attgccgaacttggaaatgatgctggtatcatcggtgcagcaagtcttgcaagtcaattt
gtagattaa

DBGET integrated database retrieval system