KEGG   Streptococcus macedonicus: SMA_0606Help
Entry
SMA_0606          CDS       T01674                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
smn  Streptococcus macedonicus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:smn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMA_0606 (gpmA)
   01230 Biosynthesis of amino acids
    SMA_0606 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMA_0606 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SMA_0606 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMA_0606 (gpmA)
Enzymes [BR:smn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SMA_0606 (gpmA)
Exosome [BR:smn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SMA_0606 (gpmA)
  Exosomal proteins of melanoma cells
   SMA_0606 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
605832..606524
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEEGTKQAIEAGKLIKEAGIEFDFAFTSVLKR
AIKTTNLALEAADQLWVPVEKSWRLNERHYGALTGQNKAEAAEKWGDEQVHIWRRSYDVL
PPAMAKDDKYSAHTDRRYAHLDDTVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKQLSDDEIMDVEIPNFPPLVFEFDEKLNVTNEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattagtgtttgcacgccacggtgaatctgaatggaacaaagctaaccttttc
actggttgggctgatgttgacctttcagaagaaggtacaaaacaagctatcgaagctgga
aaattgattaaagaagcaggaatcgaatttgactttgctttcacttcagttcttaaacgt
gctatcaaaacaactaaccttgctcttgaagctgctgaccaactttgggttccagttgaa
aaatcatggcgcttgaacgaacgtcactacggtgctttgactggtcaaaacaaagctgaa
gctgctgaaaaatggggtgacgaacaagttcacatctggcgtcgttcatacgatgtattg
ccaccagctatggctaaagatgacaaatactcagcacacactgaccgtcgttatgctcac
cttgacgacacagtaattccagatgctgaaaacttgaaagttactttggaacgcgctctt
ccattctgggaagataaaatcgctccagctcttaaagacggtaaaaacgtctttgtaggt
gcacacggtaactcaatccgcgctcttgtaaaacacattaaacaattgtcagatgacgaa
attatggatgttgaaatccctaacttcccaccacttgtattcgaattcgacgaaaagtta
aacgttacaaacgaatactaccttggtaaataa

DBGET integrated database retrieval system