KEGG   Streptococcus macedonicus: SMA_0610Help
Entry
SMA_0610          CDS       T01674                                 

Gene name
recR
Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
smn  Streptococcus macedonicus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:smn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
610526..611122
Genome map
AA seq 198 aa AA seqDB search
MLYPTPIAKLIDSFTKLPGIGIKTATRLAFYTIGMSDEDVNEFAKNLLAAKRELTYCSVC
GNLTDEDPCNICTDETRDHSVILVVEDSKDVSAMEKIQEYHGLYHVLHGLISPMNGVGPD
DINLKSLITRLMDSEVNEVIIATNATADGEATSMYISRVLKPAGIKVTRLARGLAVGSDI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgctttatccaacacctatcgcaaagctgattgatagttttacaaaattaccaggaatt
ggtataaaaacagcaacacgtttggctttctacacgattggaatgtcagatgaagatgtg
aatgaattcgccaaaaatttattggcagctaagcgtgaattgacttattgttctgtttgt
gggaatttaacagatgaagacccttgtaatatctgtacagatgaaactcgtgatcattcc
gttattttagtggttgaagattcaaaagacgtatctgccatggaaaaaattcaagagtat
catggcttgtaccatgtcttgcatggcttgatttcaccaatgaatggtgtcggaccagat
gatattaatttgaaatcattaattacacgtttaatggatagtgaggttaacgaagtgatt
attgcaaccaatgcaaccgcagacggtgaagcaacatctatgtatatctcacgtgtccta
aaaccagcaggaatcaaggtaacacgtttagcacgtggactggctgttggctcagacatc
gaatacgccgacgaagtcaccctacttcgtgccatagaaaaccgaacagaattgtag

DBGET integrated database retrieval system