KEGG   Streptococcus macedonicus: SMA_0763Help
Entry
SMA_0763          CDS       T01674                                 

Gene name
rfbC
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
smn  Streptococcus macedonicus
Pathway
smn00521  Streptomycin biosynthesis
smn00523  Polyketide sugar unit biosynthesis
smn01130  Biosynthesis of antibiotics
Module
smn_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:smn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SMA_0763 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SMA_0763 (rfbC)
Enzymes [BR:smn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SMA_0763 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: CCF02054
UniProt: H2A5R4
Position
762211..762804
Genome map
AA seq 197 aa AA seqDB search
MTEQFFEKELAARPVEGIPGMLEFDIPVHGDNRGWFKENFQKAKMVPLGFPESFFAEGKL
QNNVSFSRKNVLRGLHAEPWDKYISVADGGKVLGSWVDLREGESFGNTYQTVIDASKGIF
VPRGVANGFQVLSDTVSYSYLVNDYWALELKPKYAFVNYADPTLGIKWENLEEAEVSEAD
KNHPLLKDVKPLKVEDL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacaattttttgaaaaagaattagctgcgcgtccagttgaaggtattcctgga
atgctcgaatttgatattccagttcatggagacaatcgtggctggttcaaagaaaacttc
caaaaagcaaaaatggtgccacttggttttccagaaagtttctttgcagaaggaaagctc
caaaacaatgtgagcttctcacgtaaaaatgtacttcgtggcctacatgcagaaccatgg
gacaaatacatttcagtcgctgatggcggtaaagtgctaggctcttgggttgacctccgt
gaaggtgagtcatttggtaacacttaccaaacagtcattgatgcctcaaaaggtattttc
gtgccacgtggtgtcgcaaatggtttccaagtactatcagatactgtttcctacagctac
cttgtcaacgactactgggcacttgaattgaagcctaagtatgcctttgtcaattatgct
gaccccacacttggcatcaaatgggaaaatcttgaagaagcagaagtttcagaagcagac
aagaaccatccgctgcttaaggatgtcaaaccattgaaagtagaagatttgtaa

DBGET integrated database retrieval system