KEGG   Streptococcus macedonicus: SMA_0798Help
Entry
SMA_0798          CDS       T01674                                 

Gene name
acoC
Definition
Dihydrolipoamide acetyltransferase component (E2) of acetoin dehydrogenase complex
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smn  Streptococcus macedonicus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMA_0798 (acoC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMA_0798 (acoC)
   00020 Citrate cycle (TCA cycle)
    SMA_0798 (acoC)
   00620 Pyruvate metabolism
    SMA_0798 (acoC)
Enzymes [BR:smn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SMA_0798 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
797213..798607
Genome map
AA seq 464 aa AA seqDB search
MANEIIMPKLGVDMQEGEILEWKKAEGDEVNEGDILLEIMSDKTNMEIEAEDSGVLLKIV
HPAGDVVAVTEVIGYIGAEGETLVDSVGEKHVEPLASAQEAKAQPLQASTAPAISQKTSE
TGKVRATPAARKLARERGIDLEKITGSGENGRIHKEDVEQFSKIRVTPLARRIAKDRGVD
LETLVGTGVSGKITKEDVLASLGDVAPQKEQADVKVTAQAGALADVTAASDGVEVIKMSA
MRKAISKGMSHSYFTAPTFTLNYDIDMTNLIALRKQLIEPIMAKTGYKVTFTDLIGLAVI
KTLMKEEHRFLNASLINDAQDIELHHFVNLAIAVGLSEGLVVPVVHGADQMSLSDFVVAS
KDVIQKAQAGKLKAAEMSGSTFTITNLGMFGVKSFNPIINQPNSAILGISATIETPIVHD
GEVVIRPIMGMSLTIDHRLVDGMNGAKFMLDLKALLENPLELLI
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaatgaaattattatgccaaagcttggtgtggacatgcaagaaggagaaattctt
gaatggaaaaaagctgaaggtgatgaggtcaatgagggtgatattctgcttgaaatcatg
tctgataagaccaatatggaaatcgaagctgaagattctggcgtgctgttgaaaatcgtt
catccagcaggtgatgtcgtagctgttaccgaagttatcggctatatcggagcagaaggt
gaaactcttgttgattctgtgggtgagaaacatgttgaaccgttagcatcggctcaggaa
gcgaaagctcaaccgttgcaagcaagcacagcgccagcgatttcccaaaagacgtctgaa
actggaaaagtccgtgctacgcctgctgctagaaagctagcacgtgagcgaggtattgac
cttgaaaaaatcactggcagcggtgaaaatgggcggattcacaaggaagatgtggaacaa
tttagtaagattcgtgtgacgccactggctcgtaggattgcaaaggacagaggtgttgac
cttgagacactggtaggaacgggtgtttctggtaagattaccaaggaagatgttttagca
agtctaggtgatgttgcgccgcaaaaagaacaagcagatgtaaaagtgacagcgcaagcg
ggagctttggctgatgttacggctgcaagtgacggagttgaagtcattaagatgtctgct
atgcgtaaggcaatttcaaaggggatgagccattcttactttacggcaccgacctttacg
cttaattatgatattgatatgacgaatctgattgccctgcgtaagcaacttattgagcca
attatggcaaagacgggttataaggtgacctttacggacttaattgggcttgctgtgatt
aagaccttgatgaaggaggaacatcgtttccttaatgcttctctgattaacgacgctcaa
gacatcgaactacatcattttgtcaatcttgcaatcgctgttgggctttctgaaggttta
gtggttcctgtggttcatggtgcagaccagatgagtttgtcagactttgtggtagcatca
aaagatgtgattcaaaaagcacaagctggtaaattgaaagcagctgaaatgtctggctca
acattcaccataacgaaccttggaatgtttggagtgaagtcgtttaatccgattattaat
caaccaaattcggcaatccttgggatttcagcaactattgaaacacccatcgttcatgac
ggtgaagtggttattcgcccaattatgggaatgagtttgaccattgatcaccgattggtt
gacggaatgaatggtgcaaaattcatgctagatttaaaagcgcttctcgaaaatccgcta
gaattgctaatctaa

DBGET integrated database retrieval system