KEGG   Streptococcus macedonicus: SMA_0901Help
Entry
SMA_0901          CDS       T01674                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
smn  Streptococcus macedonicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:smn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMA_0901 (pfkA)
   01230 Biosynthesis of amino acids
    SMA_0901 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMA_0901 (pfkA)
   00030 Pentose phosphate pathway
    SMA_0901 (pfkA)
   00051 Fructose and mannose metabolism
    SMA_0901 (pfkA)
   00052 Galactose metabolism
    SMA_0901 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SMA_0901 (pfkA)
Enzymes [BR:smn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SMA_0901 (pfkA)
Protein phosphatases and associated proteins [BR:smn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SMA_0901 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
892991..894007
Genome map
AA seq 338 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAVRAVVRKAIKEGIEVFGINRGYAGMVEGDIFPLDAQSVSNI
LSHGGTFLQSARYPEFATLEGQLAGIEQLKKHGIEAVVVIGGDGSYHGAMRLTEHGFPAV
GIPGTIDNDIAGTDYTIGFDTAVNTAMEALDKIRDTSFSHKRTFVVEVMGRNAGDIALWS
GIAAGADQIIIPEEEYDIKDVVAKVKDGYENRGKERHLIVLAEGVMHAEKFAELMKEAGD
TSDLRATNLGHILRGGAPSPRDRVLASWMGAHAVELLLEGRGGLAVGIHNEELVESPILG
TKEEGALFSLAEEGNIIVNMPHKARLDFAKLNRDLAHL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgactagtggcggcgacgctcctggtatgaatgctgctgtt
cgtgcagttgttcgtaaagcaattaaagaaggaatagaagttttcggaatcaaccgtggc
tatgctggtatggttgaaggcgatatcttcccattggatgctcaaagtgtgtcaaatatt
ttgtcacatggtggtacattccttcaatctgctcgttatcctgagtttgcaactcttgaa
ggacaattagcaggtatcgaacaacttaaaaaacacggtattgaagctgtcgttgttatc
ggtggtgatggttcttatcatggtgctatgcgcttaactgaacatggtttcccagctgtc
ggtattccaggtacgattgataacgatatcgctggtacagattatactattgggtttgat
acagctgttaacacagctatggaagctcttgataaaatccgtgatacatcattcagtcac
aaacgtactttcgttgtcgaagtaatgggacgtaacgctggggatatcgctctttggtct
ggtattgctgcaggtgctgaccaaatcatcatccctgaagaagaatacgacatcaaagac
gttgttgcaaaagttaaagatggttatgaaaacagaggtaaagaacgtcacctaatcgtt
cttgctgaaggtgttatgcatgctgaaaaatttgctgaattgatgaaagaagctggagat
actagcgaccttcgtgctacaaaccttggtcacatccttcgtggtggtgctccatcacct
cgtgatcgtgttcttgcttcttggatgggtgcacacgccgttgaacttcttcttgaagga
cgtggtggacttgctgttggtatccacaacgaagaattggtagaaagcccaatccttgga
acaaaagaagaaggtgcattgttctcattggcagaagagggaaacattattgttaacatg
cctcacaaagcacgccttgactttgctaaattaaaccgtgaccttgctcacttatag

DBGET integrated database retrieval system