KEGG   Streptococcus macedonicus: SMA_0901Help
Entry
SMA_0901          CDS       T01674                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
smn  Streptococcus macedonicus
Pathway
smn00010  Glycolysis / Gluconeogenesis
smn00030  Pentose phosphate pathway
smn00051  Fructose and mannose metabolism
smn00052  Galactose metabolism
smn00680  Methane metabolism
smn01100  Metabolic pathways
smn01110  Biosynthesis of secondary metabolites
smn01120  Microbial metabolism in diverse environments
smn01130  Biosynthesis of antibiotics
smn01200  Carbon metabolism
smn01230  Biosynthesis of amino acids
smn03018  RNA degradation
Module
smn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:smn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMA_0901 (pfkA)
   00030 Pentose phosphate pathway
    SMA_0901 (pfkA)
   00051 Fructose and mannose metabolism
    SMA_0901 (pfkA)
   00052 Galactose metabolism
    SMA_0901 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SMA_0901 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SMA_0901 (pfkA)
Enzymes [BR:smn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SMA_0901 (pfkA)
Protein phosphatases and associated proteins [BR:smn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SMA_0901 (pfkA)
Messenger RNA biogenesis [BR:smn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SMA_0901 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: CCF02192
UniProt: H2A643
Position
892991..894007
Genome map
AA seq 338 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAVRAVVRKAIKEGIEVFGINRGYAGMVEGDIFPLDAQSVSNI
LSHGGTFLQSARYPEFATLEGQLAGIEQLKKHGIEAVVVIGGDGSYHGAMRLTEHGFPAV
GIPGTIDNDIAGTDYTIGFDTAVNTAMEALDKIRDTSFSHKRTFVVEVMGRNAGDIALWS
GIAAGADQIIIPEEEYDIKDVVAKVKDGYENRGKERHLIVLAEGVMHAEKFAELMKEAGD
TSDLRATNLGHILRGGAPSPRDRVLASWMGAHAVELLLEGRGGLAVGIHNEELVESPILG
TKEEGALFSLAEEGNIIVNMPHKARLDFAKLNRDLAHL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgactagtggcggcgacgctcctggtatgaatgctgctgtt
cgtgcagttgttcgtaaagcaattaaagaaggaatagaagttttcggaatcaaccgtggc
tatgctggtatggttgaaggcgatatcttcccattggatgctcaaagtgtgtcaaatatt
ttgtcacatggtggtacattccttcaatctgctcgttatcctgagtttgcaactcttgaa
ggacaattagcaggtatcgaacaacttaaaaaacacggtattgaagctgtcgttgttatc
ggtggtgatggttcttatcatggtgctatgcgcttaactgaacatggtttcccagctgtc
ggtattccaggtacgattgataacgatatcgctggtacagattatactattgggtttgat
acagctgttaacacagctatggaagctcttgataaaatccgtgatacatcattcagtcac
aaacgtactttcgttgtcgaagtaatgggacgtaacgctggggatatcgctctttggtct
ggtattgctgcaggtgctgaccaaatcatcatccctgaagaagaatacgacatcaaagac
gttgttgcaaaagttaaagatggttatgaaaacagaggtaaagaacgtcacctaatcgtt
cttgctgaaggtgttatgcatgctgaaaaatttgctgaattgatgaaagaagctggagat
actagcgaccttcgtgctacaaaccttggtcacatccttcgtggtggtgctccatcacct
cgtgatcgtgttcttgcttcttggatgggtgcacacgccgttgaacttcttcttgaagga
cgtggtggacttgctgttggtatccacaacgaagaattggtagaaagcccaatccttgga
acaaaagaagaaggtgcattgttctcattggcagaagagggaaacattattgttaacatg
cctcacaaagcacgccttgactttgctaaattaaaccgtgaccttgctcacttatag

DBGET integrated database retrieval system