KEGG   Streptococcus macedonicus: SMA_1186Help
Entry
SMA_1186          CDS       T01674                                 

Gene name
dhfR
Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
smn  Streptococcus macedonicus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SMA_1186 (dhfR)
   00670 One carbon pool by folate
    SMA_1186 (dhfR)
Enzymes [BR:smn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SMA_1186 (dhfR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1152015..1152509)
Genome map
AA seq 164 aa AA seqDB search
MTKKIVAIWAEDENRLIGVDDGLPWRLPKELKHFKETTMGQALLMGRVTFDGMNRRILPG
RETLILTRDKSFEADGVTIVHDMDEVFDWFEKQDKTLYIVGGASIYKAFLPHCDAIIKTT
VHGVFEGDTYFPDVDLTSFRKVSETFNEKDDKNTYDFTITVLEK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaaaatcgttgccatttgggcagaagatgaaaatcgtttaatcggagtagat
gatggcttgccatggcgtttaccaaaagaattaaaacactttaaagaaacaaccatggga
caagcccttttaatggggcgtgtcacctttgacggaatgaatcgccgtattcttccagga
cgcgaaacattgattttaacaagagacaagtcctttgaggcagatggtgtaacaatcgtt
catgacatggatgaggtttttgattggtttgaaaagcaggataagaccctttatatcgtt
ggtggggctagtatctataaagcttttctaccgcattgtgatgctattattaaaacaacg
gttcatggtgtttttgaaggtgatacgtatttcccagacgttgatttgacaagctttaga
aaagtgtctgaaaccttcaacgaaaaagatgataaaaatacctacgactttaccattaca
gtcttagaaaaataa

DBGET integrated database retrieval system