KEGG   Streptococcus macedonicus: SMA_1332Help
Entry
SMA_1332          CDS       T01674                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
smn  Streptococcus macedonicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:smn00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1302385..1303926)
Genome map
AA seq 513 aa AA seqDB search
MKKRASGVLMHITSLPGKQGVGTFGQEAYDFVDFLVETDQTYWQILPLTTTSYGDSPYQS
FSATAGNTHLIDLELLSEQGYLDKKDFETVNFGDDLESVDYARIFELRRPILEKAVKAFL
SQKENVEALAEFEKDTSWLQDFADFMAIKEFFDNKALQEWDDKAVVRREEKALETYRAKL
KDAILYHKVTQYFFYQQWAKLKAYANENGIEIIGDMPIYVSADSVEVWTMPELFKVDSDK
NPLCIAGVPADEFSDDGQIWGNPIYDWKNHAKTNYAWWVYRIQESFKLYDLLRIDHFKGF
SDYWEIRGDYETANDGSWEPGPGRALFDVVKDELGDLPIIAENLGYIDAKAEQLLTDTGF
PGMKILEFGFYDTEGKSIDAPHNCNKNSVAYNGTHDNEVVNGWYDNLTDEQKAFVNAYTH
RSEDEPITEAMLRTLFATVSDVAIATMQDLLDKPADSRMNIPNTVGGNWQWRMLKEDLTD
ERKVFLKDITALYCRKNTFKTTIKEEKETKNDN
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgtgcaagtggtgtattgatgcatatcacatcactacctggaaagcaaggg
gtgggaacattcggacaagaagcctatgactttgttgatttcttagttgaaactgaccaa
acatattggcaaattttaccactaacaacgacaagttatggtgattccccttatcaatcg
ttctcagctactgcggggaatacgcatctgattgaccttgaactccttagtgaacaaggt
taccttgataaaaaagattttgaaaccgttaattttggtgatgatttagagtctgttgat
tacgctcgtatttttgaattgcgccgtcctattttggaaaaagccgtcaaagccttctta
agccaaaaggaaaatgttgaagcattagctgaatttgaaaaagatactagctggctccaa
gattttgcagatttcatggcaattaaagaattttttgataacaaagctctacaagaatgg
gatgataaagcggttgttagacgagaagaaaaagctctcgaaacttaccgtgctaaatta
aaagacgctattctttaccataaagtcactcaatatttcttctatcaacaatgggctaag
ctcaaagcttatgctaatgaaaatgggattgaaattattggtgatatgccaatttacgtt
tcagctgatagtgttgaagtgtggacaatgcctgaactgttcaaagtagatagtgataaa
aatccactttgcattgctggtgttcctgcggatgaattcagtgatgatggtcagatttgg
ggaaatccaatttatgattggaaaaaccatgctaagacgaattatgcttggtgggtttac
cgtattcaagaaagcttcaaattgtatgatcttcttcgtattgatcatttcaaaggcttc
tcagattattgggaaatccgtggtgactacgaaacagcaaatgacggtagttgggaacca
ggtccaggacgtgctttgtttgatgttgtcaaagacgaacttggcgaccttccaattatt
gctgaaaaccttggttacattgatgcaaaagctgaacagttgttgacggatacaggtttt
ccaggcatgaagattcttgaatttggcttctatgataccgaaggaaagagtattgatgca
ccgcataactgcaataaaaacagtgttgcttacaatggtacacacgataatgaagtcgtc
aacggttggtatgacaacttgactgacgagcaaaaagcatttgtgaatgcttacactcac
cgtagtgaagacgaaccgattacagaagctatgcttcggacattgtttgcgactgttagt
gatgttgcgattgcgacaatgcaagatctacttgataaaccagctgatagccgcatgaat
attccaaatactgttggtggcaactggcaatggcgtatgcttaaggaagatttgacagat
gagcgaaaagttttcttgaaagacattacagcactctattgccgcaaaaatacatttaaa
acgacaattaaagaagaaaaggaaactaaaaatgacaactaa

DBGET integrated database retrieval system