KEGG   Streptococcus macedonicus: SMA_1519Help
Entry
SMA_1519          CDS       T01674                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
smn  Streptococcus macedonicus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:smn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMA_1519 (tpiA)
   01230 Biosynthesis of amino acids
    SMA_1519 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMA_1519 (tpiA)
   00051 Fructose and mannose metabolism
    SMA_1519 (tpiA)
   00562 Inositol phosphate metabolism
    SMA_1519 (tpiA)
Enzymes [BR:smn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SMA_1519 (tpiA)
Exosome [BR:smn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SMA_1519 (tpiA)
  Exosomal proteins of bladder cancer cells
   SMA_1519 (tpiA)
  Exosomal proteins of melanoma cells
   SMA_1519 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1493718..1494476)
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIVGNWKMNKNPEEAKAFVEAVVSKLPSSELVEVGIAVPALVLSTVLAAAKGSNL
KVAAENCYFENAGAFTGENSPKVLSEMGTDYVVIGHSERREYFHETDEDINKKAKAIFAN
GMLPIICCGETLETYEAGKAAEFVGGQVSAALAGLSEEQVSSLVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDTVAADFGQAVADKVRVQYGGSVKPENIAAYMACPDVDGALVGGASLQ
PESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgttggtaactggaaaatgaacaaaaatccagaagaagct
aaagcatttgttgaagcagtagtttctaaattgccttcatcagaacttgttgaagttggt
atcgctgttcctgcacttgtcctttcaacagttcttgctgcagctaaaggttcaaacctt
aaagttgctgctgaaaactgctactttgaaaacgctggtgctttcactggtgaaaacagc
cctaaagtattgtctgaaatgggaactgactacgttgtaatcggtcactcagaacgtcgc
gaatacttccacgaaactgacgaagatatcaacaaaaaagctaaagcaatctttgctaac
ggtatgcttccaatcatctgctgtggtgaaactcttgaaacttacgaagctggtaaagct
gctgaattcgtaggtggacaagtttcagcagctcttgctggattgtcagaagaacaagtt
tcttcacttgttatcgcatacgaaccaatctgggctatcggtactggtaaatcagctagc
caagatgacgcacaaaaaatgtgtaaagttgttcgtgacacagttgcagcagacttcggt
caagcagtagctgataaagttcgcgttcaatacggtggttcagttaagcctgaaaacatt
gctgcttacatggcttgcccagatgttgatggtgcccttgttggtggtgcatcacttcaa
ccagaaagcttccttgctcttcttgactttgtaaaataa

DBGET integrated database retrieval system