KEGG   Streptococcus macedonicus: SMA_1527Help
Entry
SMA_1527          CDS       T01674                                 

Gene name
gpo
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
smn  Streptococcus macedonicus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:smn00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SMA_1527 (gpo)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SMA_1527 (gpo)
Enzymes [BR:smn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SMA_1527 (gpo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1504951..1505436
Genome map
AA seq 161 aa AA seqDB search
MTNLYDFTVKAQDGSDVQLSKYQGKILLIVNTATGCGLTPQYEGLQKLYDTYHDKGFEIL
DFPCNQFLNQAPGNADEINTFCTLNYQTTFPRFAKIKVNGKEADPLYDWLKSEQKGPLGK
SIEWNFAKFLIDQNGNVIKRFSSKTEPETIVTEIESLINDK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgactaatctttatgactttactgtcaaagcccaagacggctctgatgtccaattgtca
aaataccaaggcaaaatcctactcattgtcaatacggcaacaggttgtggcttaacccca
caatacgaaggactacaaaagctttatgacacttaccatgacaaaggatttgaaatttta
gattttccttgtaatcaatttttaaatcaagcgccaggaaacgccgacgaaatcaatacc
ttttgcaccttgaattaccagacaacttttcctcgctttgcgaaaattaaagtcaacggt
aaagaagccgacccactctatgattggctaaaaagtgaacaaaagggaccacttggcaag
agtattgaatggaactttgcaaaatttcttatcgaccaaaatggcaatgtcatcaaacgt
ttttcatcaaaaacagaaccagaaacaattgttacagaaattgaaagccttatcaatgac
aaatag

DBGET integrated database retrieval system