KEGG   Streptococcus macedonicus: SMA_1759Help
Entry
SMA_1759          CDS       T01674                                 

Gene name
dapE
Definition
acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
smn  Streptococcus macedonicus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:smn01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:smn00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1706407..1707789)
Genome map
AA seq 460 aa AA seqDB search
MVVSDNNQLQKFENDDVAQYYFEILRQLIAKKSIFAQQIGLAEVANYLGDIFTEAGAEVT
IDDTCTAPFVLARFKSNRPDAQTIIFYNHYDTVPADDDQPWSSNPFELTVRDGYMYGRGV
DDDKGHITARLTAVQKYRREFGDFPVNIIFIMEGSEESASVGLETYLEKYADELRGADLL
VWEQGISNAKGQIEISGGTKGIVTFDMIVDSAKVDIHSKFGAVIESASWYLLNAIASLRD
ETGRILVDGIYDQVIEPSERELSLILEHANLDADNLKTLYGLNLPMLTRDKEKLVRTLFF
EPAITIEGISTGYQGQGVKTILPAKAQTKMEVRLVPGLEPKDVLQKIEQHLQQHGFEQVE
LVYTLGEKAYRSDMSAPTILNVIEIAKTFSPNGVSVLPTTAGTGPMHQFFEVLEVPIASF
GIGNPDSRDHAGDENVNLADYYTHIEMIEELIKSYEKTDY
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggtagtaagtgataataatcagttgcagaagtttgaaaatgatgacgttgctcaatat
tattttgagattttacgtcagttaattgctaaaaaatcgatttttgcacagcagattggg
ttagcagaagtagcaaattatctaggcgatatttttactgaagctggtgctgaggtaacg
attgacgatacttgtacggcgccgtttgttttggcgcgttttaagagcaatagacctgat
gctcagacgattattttttacaaccattatgacactgtgccagctgatgatgaccagcct
tggtcgtcaaatccttttgaattaaccgtccgtgatggctacatgtatggacgtggtgtt
gatgatgataaagggcatatcacagcacgcttgacagccgttcagaagtatcgccgtgag
tttggagattttccagttaacattatatttattatggaaggttcggaagaatcagcttct
gtgggtcttgaaacctatcttgaaaaatacgctgatgagctccgtggtgcggatttattg
gtgtgggagcaaggtatttcaaatgccaaaggtcagattgaaatttctggtggaacaaaa
ggtattgtcacctttgatatgattgttgattctgctaaggttgatattcattcgaaattt
ggtgcggtcattgagtcagcatcatggtatttgcttaatgcaattgctagccttcgtgat
gaaactggtcgcattttggttgacggaatttatgaccaagtcattgagccaagtgagcgt
gagttgtcacttatcctagagcatgccaatcttgatgccgataacctaaaaacactatat
ggtttgaatttgccaatgttgacaagggataaggaaaagttagttcgaacgcttttcttt
gaaccagctatcacgattgaaggaatttcaacaggatatcaaggtcaaggtgtcaaaacg
attctaccagctaaagctcagactaaaatggaagttcgtttggttcctgggcttgagcca
aaagatgttcttcagaagattgaacaacatttgcaacaacatggctttgaacaggtagag
ttggtttacacattgggcgaaaaggcttatcgtagtgatatgtctgccccgactattctc
aatgtgattgagattgcaaagacattttcaccaaatggtgtttcagttttgccgacgact
gctggtactggaccaatgcaccaattctttgaagtattagaagttccgattgcttctttt
ggtattggcaatccagacagccgtgaccatgctggagatgaaaatgttaatttggcggat
tattacacccacattgaaatgattgaggagttgattaagagttatgagaaaaccgattat
taa

DBGET integrated database retrieval system