KEGG   Streptococcus macedonicus: SMA_1851Help
Entry
SMA_1851          CDS       T01674                                 

Gene name
yrrC
Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
smn  Streptococcus macedonicus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:smn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SMA_1851 (yrrC)
Enzymes [BR:smn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SMA_1851 (yrrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1793091..1795568
Genome map
AA seq 825 aa AA seqDB search
MEYFFSGTIDRIIFENASNFFKILLLEIEDTDSDFDDFEIIVTGTIADIIEGENYTFWGE
LTQHPKYGEQLRVTRYERSKPTSSGLIKYFSSDHFKGIGKKTAEKIVQLYGDNTIDKILE
DPSKLDSISGLSKENKDNFLTKLKLNYGTELILAKLAEYGLTNRVAFEIFNQYKEDSLDI
IQENPYQLVEDIQGIGFKIADQLAEQLGIEADAPQRFRAALVHSLFETSIERGDTYVEAR
DLLENAITTLEEARQIELDPAAVAKELSTLIAEDKVQNVGTKIFDNTLFYAESGIKKHLT
RILDTPLNQNFSDVDLQEEIADVEEAFGISYDDVQKHAIKEALKSKVFILTGGPGTGKTT
VINGLIAAYADLHQIDLEKKDIPIILAAPTGRAARRMNELTGLPSATIHRHLGLNGDNDY
QAIDDYLDCDLIIIDEFSMVDTWLANQLFSSISSNTQVIIVGDSDQLPSVGPGQVLADLL
KIEALPQLALTKIFRQSEDSTIVTLANQMRLGKLPADFTQKKADRSYFEASAQYIPEIIP
KIVSAAVKSGIDPQEIQILAPMYRGAAGINRLNTIIQDLLNPLKDQLSFAFGEMNFRKDD
KILHLINDAELNVFNGDIGYITDLIPAKYTESKQDELYMSFDGTEVIYPRNEWHKITLAY
AISIHKSQGSEFQVVILPITRQSHRLLQRNLIYTAITRSKSKLVMLGEIAAFDYAIKNEG
AKRNTYLVQRFTSSAQEESIDLQTEISQQTSPKTDNEAEKITSPTSPQTNISKEENIQLT
LDIAENEQTQTEQEPKIYRLTEENLAFINPMIGITQADIEQFFKK
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atggaatacttcttttctggcacaattgaccgtattatttttgaaaatgccagtaatttc
tttaaaattttattgctcgaaattgaggataccgattcagactttgatgattttgaaatc
attgttactggaacaattgccgatattatcgagggagaaaattatacgttttggggtgaa
ttaacgcaacacccaaaatatggcgaacagctcagagtcacacgttacgagcgcagcaaa
ccaacttcttctggtcttattaaatatttttcaagcgaccatttcaaaggaattggtaaa
aaaactgctgaaaaaattgtgcagctttacggcgacaataccattgataaaatcctagaa
gaccctagtaaattagacagtatttctgggctttctaaggaaaataaagacaacttttta
accaaactcaagcttaattatggtacagagctcattttagccaagttggcagagtatggc
ttaactaatcgtgttgcctttgaaatttttaatcaatacaaggaagacagtcttgatatt
atccaagaaaatccttatcaattggtcgaagacattcaagggattgggtttaaaatcgct
gaccaactcgctgaacaattaggaatcgaagcagatgcccctcaacgttttcgtgccgct
ctcgtgcacagtctttttgaaacttctattgagcgaggagatacttacgtcgaagcgcgt
gatttgcttgaaaatgccattaccacccttgaagaagctagacaaattgagttagacccc
gcagccgttgccaaagaattatcaacgcttatcgctgaagataaggtacaaaatgtcggt
accaaaatttttgacaatactcttttctatgctgaatcaggtatcaaaaaacacctgaca
cgtatccttgatacgccactcaaccaaaacttttcagatgttgacttgcaagaagaaatc
gctgacgttgaggaagctttcggcatttcttacgatgatgtgcaaaaacatgctatcaaa
gaagcgctcaagagcaaggtgtttattttgactggtggtcctggcacgggaaaaacgact
gttatcaacggtttgattgctgcctacgcagaccttcatcaaattgatcttgagaaaaaa
gatattcctatcatcttagcagcgccaacaggacgtgctgcccgccgtatgaatgaatta
acaggcttgccaagtgcgactattcaccgccatttggggttaaatggtgataacgactac
caagctattgatgactatctcgactgtgacttgattatcattgatgaattttcaatggtt
gatacttggcttgccaatcaactctttagttccatttcgtccaatactcaagtcatcatc
gttggagatagtgaccaattgccgtctgtcggtcctgggcaagtattagctgatttatta
aaaattgaagctcttcctcaactagcattgactaaaatctttagacaatcggaagattca
accattgttacacttgctaatcagatgagacttggaaaattaccagctgacttcacacaa
aagaaagctgaccgttcttattttgaagcaagtgcacaatatatcccagaaataattcct
aaaattgtcagcgcagctgttaagagtggcattgacccacaagaaatacaaattcttgcc
ccaatgtaccgtggcgcagctgggattaatcgacttaataccattattcaggatttactt
aacccgcttaaagatcaactctcgtttgcctttggtgagatgaatttccgtaaggatgac
aaaattctccacctcatcaacgatgctgaactcaatgttttcaatggtgatatcggctat
attacagaccttattcctgctaaatataccgaatccaaacaagacgagctttacatgtct
tttgacggcactgaagttatttaccctcgtaatgaatggcataaaattacccttgcttac
gctatatcaatccacaaatcacaaggtagcgaatttcaggttgtcattttgccgatcact
cgccaaagtcacagactcttacaacgtaacctcatttacacagctatcacccgctctaag
agtaaattagtgatgttaggggaaattgccgcctttgattacgccataaaaaacgaaggc
gctaagcgcaacacctatcttgttcaacgctttacaagctccgctcaagaagaaagtatt
gatttacaaactgaaatttctcaacaaacatcacctaaaacagataatgaagctgagaaa
atcacctctccaacttctccccaaacaaatatttctaaagaagaaaacatccaactgaca
ctagatattgccgaaaatgagcaaacacaaacagagcaagaaccaaaaatctatcgcttg
acagaagaaaacttggcatttatcaacccaatgattggcattacccaagccgacattgaa
caattttttaagaaataa

DBGET integrated database retrieval system