KEGG   Streptococcus macedonicus: SMA_2054Help
Entry
SMA_2054          CDS       T01674                                 

Gene name
cap4C
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
smn  Streptococcus macedonicus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SMA_2054 (cap4C)
   00052 Galactose metabolism
    SMA_2054 (cap4C)
   00500 Starch and sucrose metabolism
    SMA_2054 (cap4C)
   00520 Amino sugar and nucleotide sugar metabolism
    SMA_2054 (cap4C)
Enzymes [BR:smn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SMA_2054 (cap4C)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1997602..1998516
Genome map
AA seq 304 aa AA seqDB search
MRKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKS
KRSIEDHFDSNFELEYNLEHKGKTDLLKLVNDTTAINLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDINKNKAVPLTKQLINDYETTHASTIAVMSVPHEEVSSYGVIAPQG
EVIDGLYSVETFVEKPAPEDAPSDLAIIGRYLLTPEIFNILETQEPGSGNEIQLTDAIDT
LNKTQRVFARQFNGDRYDVGDKFGFMKTSIDYALQHPQIKDSMKQYLIDLGKELEADSKK
EETK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagttagaaaagccgtcattcccgctgctggtcttggaacacgcttcttgcca
gccactaaagcactcgctaaagagatgcttccaattgttgataaaccaaccattcaattt
atcgtcgaagaagccttgaaatcaggtattgaagacattttggttgttactgggaaatca
aaacgttcaatcgaagaccacttcgattcaaattttgagttagaatacaatttggaacat
aaagggaaaactgaccttctcaaacttgtgaatgatacaacagctattaatcttcacttt
atccgtcaaagccatccacgcggattgggagacgccgttttacaagccaaagcttttgtt
ggcaacgaacctttcgtagttatgcttggtgacgaccttatggacatcaataaaaataaa
gctgtaccattgacaaaacaactgatcaatgactacgaaaccacacacgcatcaactatc
gccgttatgtctgtaccacacgaagaagtatcatcttacggtgttattgctcctcaaggc
gaagttattgacggactttatagcgttgaaacatttgttgaaaaaccagcccctgaagat
gcaccaagtgaccttgcaatcatcggtcgttatcttcttactccagaaatcttcaatatc
cttgaaacacaagaacctggatctggtaatgaaattcaattgacagatgccattgatacc
cttaataaaacacaacgtgtttttgcacgccaatttaacggtgaccgctatgatgtcggt
gacaaatttggctttatgaaaacttctattgactatgcccttcaacaccctcaaatcaaa
gatagcatgaaacaatatcttatcgatttaggtaaagaattagaagctgattcaaaaaaa
gaagaaactaaataa

DBGET integrated database retrieval system