KEGG   Selaginella moellendorffii: SELMODRAFT_100675Help
Entry
SELMODRAFT_100675 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
smo  Selaginella moellendorffii
Pathway
smo00010  Glycolysis / Gluconeogenesis
smo00030  Pentose phosphate pathway
smo00051  Fructose and mannose metabolism
smo00052  Galactose metabolism
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
smo01200  Carbon metabolism
smo01230  Biosynthesis of amino acids
smo03018  RNA degradation
Module
smo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SELMODRAFT_100675
   00030 Pentose phosphate pathway
    SELMODRAFT_100675
   00051 Fructose and mannose metabolism
    SELMODRAFT_100675
   00052 Galactose metabolism
    SELMODRAFT_100675
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SELMODRAFT_100675
Enzymes [BR:smo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SELMODRAFT_100675
Protein phosphatases and associated proteins [BR:smo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SELMODRAFT_100675
Messenger RNA biogenesis [BR:smo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SELMODRAFT_100675
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 9656007
NCBI-ProteinID: XP_002973951
JGI: 100675
UniProt: D8RSR2
Position
Unknown
AA seq 520 aa AA seqDB search
MLAGDPSTGSCYATPSSLKLWGCVNRSRNFVRIRGSSSSVTSVLSAERVDLRDEDEIEAD
FGRKFRLPHISDVFPDLEPLPTTFSVKSSYPLPDYHFDDESKDLKKMYVHNDDRVLLKVI
EYVSPTSAGADCEGEDCKFRHLRVWRAGPRKKIYIRPEEVKAAIVTCGGLCPGLNDVIRQ
IVFTLDKYGVKNIVGIPYGYRGFFDDSLSDINLTTHYVQNIHLSGGSLLGVSRGGGQTSD
IVDSLEKRGINMLFVLGGNGTHAGANAIHDECWRRKMKVMVVCVPKTIDNDILLMDKTFG
FDTAVEAAQRAISAAYIEARSAYHGIGVVKLMGRQSGFIAQYASLASGHVNACLIPEVPF
TLHGPNGLLVYLEHLIHTQGSAVVCIAEGAGQELLPPKGSKDASGNPVLSDTGVYLQQQI
KNHFIAAGTPADVKYIDPTYMIRACQANSSDSILCTVLGQNAVHGAFAGFSGITVGLCNT
HYAYFPIPQVIDHPRRVDPSSRMWHRCITSTGQPDFTPRA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctggcgatcccagcactggatcgtgctatgcgactccctcgtctctcaagctg
tggggatgcgtcaacagatcgaggaattttgttaggatcaggggctctagcagctcggtg
acgagtgttttgagcgcggagagggtggatcttcgcgacgaggatgagattgaggccgat
tttggtagaaagtttaggcttccacacatcagcgacgtttttcccgatctagagccgctg
ccaacgacgtttagtgtcaagagcagctatcctttgccggattatcatttcgacgatgaa
tccaaggacttgaagaagatgtatgtccacaatgacgatcgtgtacttctaaaggttata
gaatatgtctcacccacgtctgcgggagctgactgtgagggtgaggattgcaaattcagg
catctaagagtgtggagagccggtccacgcaaaaaaatatatatcagacccgaggaagtc
aaagctgcgattgtaacatgcgggggactttgtcccggtcttaacgatgttattcgtcag
attgttttcactctcgataagtatggagtgaagaatattgtcggcataccgtatggctac
cggggattttttgacgatagtctgtcagatatcaatttgacgacacactatgtgcaaaat
attcacctctcgggaggcagcttgttgggagtctctcgtggaggcggacaaacaagcgac
attgtcgacagcttggagaaacgcgggatcaacatgctcttcgtgctcggtggcaatggc
acgcacgctggagctaatgccatccatgacgagtgctggcgcaggaagatgaaagttatg
gttgtctgcgtcccgaaaacgatagacaacgacatcttgctcatggacaaaacttttggt
tttgacactgctgtcgaagctgctcagagagcaatcagtgctgcgtacattgaggcaagg
agcgcttaccatggaatcggtgttgtgaaactgatggggcgccagagtggcttcatagca
cagtatgccagcttagccagtggtcacgtaaatgcgtgtctcattccggaggtccctttt
accttgcatggaccaaatggactgcttgtctatctggagcatttgatccacactcaaggc
tctgcggtggtctgtattgccgaaggagctggccaggagcttctgccgcccaagggctca
aaagacgcgtctggcaatcctgtcctatcggacaccggggtctacctccaacaacagatc
aaaaaccatttcattgccgctggaactcccgcagatgtcaagtacattgatcccacttat
atgatccgagcgtgccaggcaaactcctccgacagtatactgtgcaccgttcttggccag
aatgcggttcatggagcgttcgcgggatttagtggaatcacggtggggctttgcaacact
cactacgcttacttcccaatcccgcaagtcattgatcatccacgaagggttgatccgagc
agcaggatgtggcaccgttgtatcacatcaacagggcaaccggattttactccgcgagca
tag

DBGET integrated database retrieval system