KEGG   Selaginella moellendorffii: SELMODRAFT_101603Help
Entry
SELMODRAFT_101603 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
smo  Selaginella moellendorffii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SELMODRAFT_101603
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SELMODRAFT_101603
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SELMODRAFT_101603
Enzymes [BR:smo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SELMODRAFT_101603
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 479 aa AA seqDB search
MHHRVLQFRLYDFAAKRRLLSVRRCGSNTKVSLDEKDLPAKWYNITADLPQPPPPPLDPR
SLEPLKAEGMGALFPQELIRQEMSSDRYIGIPDEVLEVYKLWRPTPLFRAKRLERLLETP
ARIYYKYEGVSPAGSHKPNTAVPQAFYNAKEGIKRLTTETGAGQWGSALAFACSIFNLDC
EVWQVRASYDQKPHRKTMMETWGAKVYPSPSAITATGRKMLAEDPNCPGSLGLAISEAVE
VAVQDSSTHYALGSVLNHVLLHQTVIGEECLLQLAKAGETDVDILIGCTGGGSNFGGLAF
PFLREKFAGKMNPVIRAVEPAACPSLTRGVYAYDYGDTAGFTPLMKMHTLGHDFIPDPIH
AGGLRYHGMAPLISHLYNLKLMEAIAIPQKECFQGALQFARSEGIIPAPEPTHAIAATIR
EAERCRESGEAKVIVMALCGHGHFDLASYEKFLSGEIEDLDYSDEKAAAAMASIPVVKQ
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgcaccatagagttctccagttccggctgtatgattttgctgctaagagaaggctgtta
tcggttagaaggtgtggcagcaacacaaaggttagtctggatgagaaggatcttccagca
aaatggtacaacattaccgcagatttgccgcagccgccaccgcctcctctggatcctaga
agcttggagccgttgaaagcagagggcatgggggctttatttccccaagaacttattcgc
caggagatgtccagcgatcgctacattggcattccagacgaggtcctcgaggtgtacaag
ctgtggaggccaacgcctctcttcagggccaagcgactagaacggttgctagaaactcct
gcaaggatttactacaagtacgagggtgtgagtccagcgggatcacacaagccgaacacg
gccgtcccacaggcgttttacaatgccaaggaaggaatcaagcgtctcaccactgaaact
ggtgctggacagtggggaagcgctctggcttttgcttgctcaatcttcaatctcgactgc
gaggtatggcaggttcgtgcatcttacgaccagaagccacacaggaagacgatgatggag
acgtggggagcgaaagtttacccctccccgtcggctattaccgccacgggccgcaaaatg
ctagccgaggatccgaactgtccggggagcctgggccttgccatctctgaagccgtggaa
gttgctgtccaagactcgagcacgcactacgcactggggagcgtcctcaatcacgtcctt
ctccaccagacggtgatcggcgaggaatgcttgcttcagctggccaaagccggagagacc
gacgtggacatactcatcggttgcactggcggcggatcgaactttggaggcttggctttc
ccgtttcttcgggagaagttcgcagggaagatgaatccggtgatccgagcagtcgagccg
gcggcttgtccatcactcacaagaggagtgtacgcttacgactatggtgacactgccggg
tttacgcccctgatgaagatgcatacgctcgggcacgactttattccagatcccatccac
gctggaggattgaggtaccatggaatggcaccgctgatatcacacctctacaatcttaag
ctcatggaggccatagctataccgcagaaagaatgcttccaaggagctctacaatttgct
cgaagcgaaggaataattccagcacctgagccaacacacgcgatcgctgctaccatccgt
gaagcggagcgatgccgagagagtggcgaggccaaagtgattgtcatggcactgtgcggc
cacggccactttgatctcgcctcgtacgagaagtttctgagtggagagatcgaagatctc
gactattccgacgagaaagccgcggcagcgatggcctccattcccgttgtcaagcagtaa

DBGET integrated database retrieval system