KEGG   Selaginella moellendorffii: SELMODRAFT_102265Help
Entry
SELMODRAFT_102265 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K13941  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
smo  Selaginella moellendorffii
Pathway
smo00790  Folate biosynthesis
smo01100  Metabolic pathways
Module
smo_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SELMODRAFT_102265
Enzymes [BR:smo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SELMODRAFT_102265
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SELMODRAFT_102265
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_bind HPPK
Motif
Other DBs
NCBI-GeneID: 9637683
NCBI-ProteinID: XP_002974688
JGI: 102265
UniProt: D8RUH6
Position
Unknown
AA seq 506 aa AA seqDB search
MRIESRVAVRFQDATASGRLDRLSHRHFHSDEASTARVSLKSRKLEEVVIAIGGNIGDRV
RNFDTALRMMRSSGIQIKKHACLYETAPMHLLDQPLFLNSAVTATTSLDPHELLVALKEI
ERKLGRSQGSVKYGPRPIDLDIIFYGNLELSSENLRVPHPMFSGRPFVLAPLLDLLGPEV
EDSRHWSLVHQVRRHWNDIGGEGCVKREGMKKVLPVGGKLLDWQERTYVMGVLNVTPDSF
SDGGKFFTADKAVKQVQEMIEQGADFIDVGAQSTRPNAERLTTEEELRRIVPVLEGLKST
PDRSRVVLSVDTFDSNVARAAVELGADLINDVSGGSLDPKMLGTVAELGVPCVLMHMRGD
PCTMLSEANTSYSDLPRDVARELAASIEQAEVAGVPAWKIIADPGFGFSKTADQNVELLA
RLDTFRSGLTQARFGVGSIPVLAGISRKAFLGQIVGCSRAEDRDNATIAAATTAILKGAN
VIRAHNVKAVRDGAMVADSIRKVLAS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaggattgaatctcgcgtagcggtcaggttccaggatgccacggccagcggcaggctg
gatcgattgtcccaccggcacttccattccgatgaagcatcgacggccagggtctctctc
aaatccaggaagctggaggaagttgtcatcgcgatcggggggaatatcggcgaccgggtc
aggaatttcgacacggcgctgaggatgatgcgaagctctggaatccagatcaagaagcac
gcctgcctgtacgagacagcgccaatgcatttgctggatcagcctctcttcctcaactcg
gccgtgactgccacaacgagcctggatcctcacgagctgctggtggccttgaaggagatt
gagagaaagctggggcgcagccaaggtagtgtcaagtatgggccgaggccgatcgatctc
gacatcattttctacgggaatttggagctcagctcggagaacttgcgagttcctcatcct
atgttctctgggaggcctttcgtgctggctccgctcctcgatcttcttggtccggaagtg
gaggatagcaggcattggtctttggtccatcaagttcggagacactggaacgatataggt
ggcgaaggatgcgtcaagagagaagggatgaagaaggtgcttcctgtgggtggaaagctt
cttgactggcaggagaggacttacgtgatgggggttcttaacgtcactccggacagcttt
agcgatggtggcaagttcttcacagctgacaaagcagtgaagcaagtccaggaaatgatc
gaacaaggagccgacttcatagatgttggagcgcaatcgacaaggccaaatgccgagcgt
cttaccactgaggaggagcttcgacggatcgtgccagtgctagagggtctgaagagcaca
ccggacagatccagggtcgtgctctcggtggataccttcgactccaacgttgcaagagca
gctgtagagctgggtgctgatctgataaacgatgtctcgggtggcagcttggatccgaag
atgctggggacagtagccgagctgggggttccttgtgtgctaatgcatatgaggggcgat
ccatgcacgatgctgagtgaagccaacacaagttacagcgatctaccacgagacgtggcc
agggaactcgctgcgagcatcgaacaagccgaggttgctggagttccggcatggaagatt
atagctgacccggggtttggattctcgaagaccgccgatcagaacgtggagctgctggcg
aggcttgatacgttcagatccgggctgacgcaggcgagatttggggttggaagtatcccg
gttctggcagggatctcgaggaaagcttttcttggtcagatcgttggctgctccagggcc
gaagaccgggacaatgccacgatcgctgctgctacaacagcgattttaaagggtgcgaat
gttataagagcccacaacgtgaaagctgttcgagatggcgctatggtggctgactcgatc
cgcaaagtcctggcaagttaa

DBGET integrated database retrieval system