KEGG   Selaginella moellendorffii: SELMODRAFT_103055Help
Entry
SELMODRAFT_103055 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
smo  Selaginella moellendorffii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SELMODRAFT_103055
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SELMODRAFT_103055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 556 aa AA seqDB search
MEVFQVAPTALHIPHPHQVLQCRRHTSSASKARQKIFQQQCRKFSSPGRTVVPVIAKQPA
VSPPSVSERSAEGKSLDCVIVGAGISGLCTAQALATKHGLPVTSILVTEARERVGGNITT
LESDGYLWEEGPNSFQPNDSMLTMAVDSGLKDELVLGDPDAPRFVLWGGQLRKVPAGLGD
LPFFDLMSFAGKIRAGLGALGLRPPPPGGEESVEQFVRRNLGDEVFERLIEPFCSGVYAG
DPSKLSMKAAFGKVWKLEDQGGSIIGGTIKLIQDKKKNPPPPRDERLPKPKGQTVGSFRK
GLISLPKAIASKLGDSIKLKWKLLSVKKTSAGLYTLVYDTPEGTTAVLAKSVVLTVPSYV
ASEILRPVSPAVSDALSEIFYPPVVAVTLSYPKSAIREDRLSNGVLSGFGQLHPRSQGVE
TLGTIYSSSLFPGRAPQGRVLLLNYIGGATNMQISMKEDDAIVEAVDRDLRKMLLKQDAE
PPKILGVRLWPRAIPQFTVGHLDHVEAARFGLRNAGVEGIFLGGNYVAGVALGRCVEGAY
ETAETVSKYLAQVLPS
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgtttcaagttgctccaacagctctccacatccctcatcctcaccaggtactc
caatgcaggcgccacacctcctccgcctccaaggccaggcagaaaatcttccagcagcaa
tgccggaagttctcgtccccgggcaggacagtagtgccagtgatcgcaaagcagccagca
gtgagcccgccctcggtgtccgagcgctccgccgagggaaagtccctggattgcgtgata
gtgggagctgggatctcggggctttgcacagcacaggcgctagcaacgaagcacggcctg
ccggttacctccatcctggtgaccgaggcaagggagagagtagggggaaatatcacgacg
ctggagtcggatggatatttgtgggaggaaggaccgaacagcttccagcccaacgattct
atgctcaccatggcggttgacagcggactgaaagacgagcttgttctcggggaccccgat
gctcctcgatttgttttgtggggtggacagcttcgcaaagtaccagcggggctcggcgat
cttccgttttttgatcttatgagctttgcgggaaagatacgagctggcctgggagctctt
ggattgaggcctccacctccgggtggtgaagaatccgtagagcagtttgttcgtcggaac
ctaggtgatgaagtctttgagaggctgatcgaacctttctgttcaggcgtttatgctggt
gatccttcgaaattgagtatgaaagctgcattcgggaaagtatggaagctggaagatcaa
ggtggaagcatcatcgggggaactattaagcttatacaggacaagaagaagaatccccct
ccgcctcgtgatgagcgactgccgaaaccaaagggtcaaactgttggatcatttcgcaag
ggtctcatctcgcttcccaaggctatagcatcgaagcttggcgatagcataaagctcaag
tggaagctcttgtctgtaaagaaaacatccgcgggcctctatacacttgtttatgatact
ccagaaggaaccacggctgttttggcaaaatctgtcgtcctcacagttccatcctacgtt
gctagtgagattttacgaccagtttcccctgcagtttctgatgccctctcagagatattc
tatcctccagttgtggcagtaactttatcgtatcctaaatcagccattcgagaagatcgc
ttgtccaatggagttttgagtggatttggccaacttcaccctcgcagccaaggagtagaa
actttaggaactatctacagttcctctctttttccaggccgtgctccccaaggccgtgtt
ctcttactgaactacataggaggtgccaccaacatgcaaatatcaatgaaggaagatgat
gctatagtggaagcagtggatagagatctccgtaagatgctcttgaaacaagacgcggag
ccaccgaaaattcttggtgttcggttgtggcctcgagcaataccgcagttcacggtaggc
cacctggatcatgttgaagcagctcggtttggtctgaggaacgctggagtcgaggggatt
ttcctgggaggtaactacgttgcgggtgttgcacttggtcgatgcgtagaaggggcgtat
gaaactgccgagaccgtgtccaagtacttggcgcaagttctaccatcttag

DBGET integrated database retrieval system