KEGG   Selaginella moellendorffii: SELMODRAFT_103062Help
Entry
SELMODRAFT_103062 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
smo  Selaginella moellendorffii
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SELMODRAFT_103062
Enzymes [BR:smo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     SELMODRAFT_103062
    2.7.1.82  ethanolamine kinase
     SELMODRAFT_103062
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 369 aa AA seqDB search
MGSLDDSEVSSGIIPSEVFPLLHKLAGKWPDVLDALDVTWRPLKGAMTNHIYECQWPGGS
GRVGEQQRKALVRIYGDSVDILFKREDEVRIFEFVSRKGQGPRLLGRFPNGRVEEFIHAR
TLTAADLRDPGISARIAAKMWEFHRLDLPESHEPKLWERLRDWLQKAEKLCSPQSMQEFH
MKRLESEIREAERTIPEPGDVIGFCHNDLQYGNIMHNDATDALTIIDYEYASYNPVAFDI
ANHFCEMAADYHTESPHRLDYAKYPGKYFSPYEDERRRFIEAYLDSSGSKASRGDVDTLL
LRVDLYELASHLHWGLWGIISVPISDIDFDFLEYARQRFQRYDERKRELWPRTMKKYPLE
SVSYILRSK
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgggatcactcgacgatagcgaagtttcaagcgggatcatccccagcgaagttttcccc
cttctccacaagctcgccgggaagtggccggatgtcttggatgctctggacgtgacatgg
aggccgctcaagggagctatgacgaatcacatctacgagtgccagtggccgggggggagc
ggcagggtcggcgagcagcagcgcaaggcgctggtgaggatttacggcgacagcgtcgac
atcctgttcaagcgggaggacgaggtccggattttcgaattcgtgtcgcgcaagggccag
gggccgcgtcttcttggccgattccccaatggccgagtggaggaattcatccacgccagg
acgctcacggctgccgatcttcgcgatcctggaatctccgcacggattgcggccaagatg
tgggaattccatcgcctggatttgccggaatcgcacgagcctaagctgtgggagcgcttg
agggactggctccaaaaggcggagaagctatgctcgcctcaatcgatgcaagaattccac
atgaagagattggagtcggagattcgcgaggccgagagaaccatcccggagcctggcgat
gtgattgggttttgccacaacgatttacaatacgggaatatcatgcacaacgatgccacc
gacgctctgaccattatagactacgagtacgccagctacaatcccgtggcgtttgacatt
gcgaatcacttctgcgagatggctgccgattatcacacggaatctccccaccggctggac
tatgccaagtatccaggcaagtacttttcgccttatgaagatgagcggcgaagattcata
gaagcatacctggattcctccggatcaaaagcgagtcgaggagatgtggacacgctactg
ctccgagttgatctgtatgaacttgcgagccacttgcactggggcctctggggaataatt
tcggtacctatctcagacattgactttgatttcctcgagtatgcgaggcagcggttccag
cgctacgatgagaggaagcgtgaattatggccaaggacaatgaagaaatatcctttagaa
agtgtatcatatatcttgagatcgaaataa

DBGET integrated database retrieval system