KEGG   Selaginella moellendorffii: SELMODRAFT_104719Help
Entry
SELMODRAFT_104719 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
smo  Selaginella moellendorffii
Brite
Protein phosphatases and associated proteins [BR:smo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     SELMODRAFT_104719
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_5 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 9646216
NCBI-ProteinID: XP_002976119
JGI: 104719
UniProt: D8RBL0
Position
Unknown
AA seq 175 aa AA seqDB search
MGNTSSMLTQYDIEEVQSHCKGIFSQREIISLYERFCILDRSGKGFILEDEFMAVPEFAL
NPLAQRLLRILEGVNFKEFVLLLSAFSPRASFKEKMEFIFKVYDSDGDGKVTTSDILGVL
RDLSGSFLTEKQREQVVIQALDQAGFSSGCMLTYEDFVKVLVKANLKMEVEVPVD
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacacatcgtccatgctcacgcagtacgatattgaggaggtccagagccactgc
aaaggaatcttctcgcagagagaaatcatctctttgtacgaaaggttttgcattttggat
cgctctggcaaaggcttcatcctcgaggacgagttcatggcagttcccgagtttgcattg
aatcctcttgctcagaggctcctcaggatactcgagggcgtgaatttcaaggaatttgtg
ctgctgctgtcggcattcagtccccgagccagcttcaaggagaagatggagttcattttt
aaggtgtatgattccgatggcgatgggaaagtgacaacaagtgacatattgggggtcctt
cgtgatctttctggttctttcctcaccgagaagcagcgagagcaagtcgtgatccaagcg
ctggatcaagcagggttctcatctggctgcatgctcacttacgaagacttcgtgaaggtg
cttgtcaaggcaaatcttaaaatggaggtggaagttcctgtggattga

DBGET integrated database retrieval system