KEGG   Selaginella moellendorffii: SELMODRAFT_104841Help
Entry
SELMODRAFT_104841 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
smo  Selaginella moellendorffii
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:smo00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 571 aa AA seqDB search
MTALPLPRHSGEEAIKVQPLKEADPNVCVAELSDSEDDDADGLFTAAAAAPDTASGSSDD
RIKVTNALSAYEKLRICYVRDKVTGDCSQKAAAALKEKNMWVNRAKRIGPVPGVEVGDIF
FFRIAMCIVGLHRQTQAGIDTIRPNENKFGELIACSLVLSGGYEDDVDSGETFTYTGQGG
NAYHGDKRQYRDQELVKGNLGLANSCKYDVPVRVTRGCLDSKSPSGKIYSYDGLYRVTHF
WAETGMSGFRVFKYSLERDPGQLELGSRIVKFSGKLQAKMEARKAVVCEDISGGRERVPI
CAVNDVDAAPGPPPPFTYITKTIFPPGFLQPSYPTGCRCVGRCGDSASCLCIGKNSNKMP
YTDGALYESKTILYECGPMCRCAASCPLRLSQQGQTRKLEVFKTENRGWGVRSWEAIPFG
SFICEYVGELISNEEAERRVGQDEYIFDIDCIKGSRSRGVDISSFFEEKDGGEICEVVED
GHMSIDAGSCGNVSRFINHSCDPNMFVQCVFNDHNDMAYPHVMMFAMKNIRPFEELSYDY
GYEIDSVRDSDGKIKKKRCYCGARRCKKRLY
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgctccctcttcctcgtcactccggcgaggaagccatcaaggtccagccactc
aaggaggcggatccaaacgtttgcgtggcggagctctcggactccgaggacgacgacgcc
gacgggctcttcaccgccgccgccgccgccccggacaccgccagcggcagcagcgatgac
cggatcaaggtgaccaacgcactttcggcgtacgagaagctccggatatgctacgtgcgc
gacaaggtgacgggcgactgctcgcaaaaggcggccgctgccctgaaggagaagaacatg
tgggtgaaccgagcgaaacgtatcggcccggttcccggggtggaagttggcgacatcttc
ttcttccggatcgcgatgtgcatcgtcggcctccaccgccagacccaggccggcatcgac
accatccggcccaacgagaacaagtttggcgagctcatcgcttgcagcttggttctctcg
ggcggatacgaggacgacgtcgacagtggcgagacgttcacgtacacgggccagggaggg
aacgcctaccacggcgacaagcggcagtaccgcgaccaggagctcgtcaaggggaacttg
ggccttgccaacagctgcaagtacgacgtccccgttcgagtcacccgcggctgcctggat
tccaagagcccctcggggaagatctacagctacgacggtctctacagggtcacccacttc
tgggccgagaccggcatgtcggggttccgggtgtttaagtacagcctcgagcgcgaccca
gggcagctggagctgggttccaggatcgtcaagttctccgggaagctccaggcgaagatg
gaggctcgcaaggcggtggtgtgcgaggacatctccggagggcgagagcgggttccaatc
tgtgccgtgaacgacgtcgacgcggccccggggccgccgccacctttcacctacatcacc
aagaccatctttcccccgggcttcctccagccgtcgtacccgacggggtgccgctgcgtg
gggcggtgcggggactcggccagctgcctgtgcatcgggaagaacagcaacaagatgcca
tacacggacggggcgctgtacgagtcgaagacgatcctgtacgagtgtggaccgatgtgc
cgctgcgcggcgagctgcccgctgcgactctcccagcaaggccagacgaggaagctcgag
gttttcaagacggagaaccgggggtggggggtgcgctcctgggaggccatcccgttcggg
agcttcatctgcgagtacgttggcgagctcataagcaacgaggaggccgagcggcgagtc
gggcaggacgagtacatcttcgacatagattgcatcaaggggagccgctcccgcggggtg
gacatatccagcttcttcgaggagaaggatggaggggagatttgcgaggtggtggaggat
ggtcatatgtccatcgacgctgggagctgcgggaacgtttccaggtttatcaaccatagc
tgcgaccccaacatgttcgtccagtgcgttttcaacgaccacaacgacatggcgtatccg
cacgttatgatgttcgccatgaagaacatccggcctttcgaggagctctcctacgactat
ggctacgagatcgactcggtgagggacagcgacgggaagatcaagaagaagcggtgctac
tgcggggctcgaaggtgtaagaagcgactctactaa

DBGET integrated database retrieval system