KEGG   Selaginella moellendorffii: SELMODRAFT_107041Help
Entry
SELMODRAFT_107041 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
smo  Selaginella moellendorffii
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SELMODRAFT_107041
  Amino acid metabolism
   00340 Histidine metabolism
    SELMODRAFT_107041
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SELMODRAFT_107041
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 378 aa AA seqDB search
YTKKFDGVELDNIVERVSDLPDPKLDPDVQAAFDVAFDNIYKFHLAQRKTQQLEVETMPG
VKCRRVARSIDAVGLYVPGGTAVLPSTALMLAVPAGIAGCETIVLATPPRSDGSICPEVL
YCAKKAGATHILKAGGAQAVAAMAWGTNSCPKVDKILGPGNQYVTAAKMLLQNSESMISI
DMPAGPSEVLVIADRNANAIHVAADLLSQAEHGPDSQVVLVAVGSVDLEAIEEQVYKQCQ
ELPRGDIASVALGHSFIVVARGMAEACKFSNVYAPEHLIVNAEDAEAWLDHIKNAGSVFL
GRWTPESVGDYASGTNHVLPTYGYARMYGGVSLDSFVKYMTVQSLSREGLGLIGPSVAMM
AEVEGLDAHKRAVTLRLA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
tacaccaagaaattcgatggagtggagcttgacaacattgtcgaaagggtgtccgacctt
ccagatccaaagctcgatccagatgtccaagctgcatttgatgtggccttcgacaacatc
tacaaattccatcttgcacagcgaaagactcaacagcttgaagtagaaaccatgcccgga
gttaaatgccggcgagttgcgaggagtatcgacgccgtcgggctttacgtccctggtgga
acggctgttcttccatcaacagcgctcatgctagcagtgcccgcaggtattgccggatgt
gagacgattgttcttgcgactccaccacggtcggacggttcaatatgtccggaagtttta
tattgtgctaagaaagctggagctactcacatcctaaaagctggaggagcacaggctgta
gctgccatggcatggggcactaattcctgtccaaaagtcgacaagatcctaggccctgga
aatcagtatgtaactgctgcgaagatgttgctacagaatagcgagtctatgatctccata
gatatgcctgctgggccctcggaagtccttgtcatcgcggatagaaacgcaaatgcgatc
catgtagctgcggatctcttatcccaggcggagcacggcccggacagccaagtggttctc
gtggctgtcggcagcgtcgacttagaggccatcgaagagcaagtttacaagcagtgccag
gagcttccccggggagatatcgcgtcggtcgcgctgggtcacagcttcatcgtcgttgct
cgaggcatggcagaggcttgcaagttctccaatgtctacgcgccggagcatctcattgtc
aacgctgaggacgctgaggcttggctggatcacataaaaaacgcagggtctgtgttcttg
ggaaggtggacgcccgagagcgttggcgactacgcgagtggaacaaaccacgtcctcccg
acgtacggctacgctaggatgtacggcggcgtgtcgctggactcgttcgtcaagtacatg
accgtacaatcgctgagccgcgaagggcttggtttgatcggcccgtccgtggcgatgatg
gccgaggtcgaaggcctggacgcccacaagcgcgctgtgacgctgcgcttggcgtga

DBGET integrated database retrieval system