KEGG   Selaginella moellendorffii: SELMODRAFT_108087Help
Entry
SELMODRAFT_108087 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
smo  Selaginella moellendorffii
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SELMODRAFT_108087
Enzymes [BR:smo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SELMODRAFT_108087
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 262 aa AA seqDB search
NELSTDVYLLDTINNRWTAPKILGTPPCPRDGFSCLTLEKDRLLVYDDKDNWLLKIGTPH
GRAGEEVISWGKARRDTLPIVICGPSGVGKGTLIAKLMQEFPDKFGFSVSHTTRKPREKE
LDGVHYHFTSRDSMELAVNEGMFLEHANVHGNMYGTSISAVEAVSDGGKRCILDIDVQGA
KSVRQSSMEALFIFILPPSFEELEKRLRGRGTETEEQVMKRLQNAKRELELGKDPFLFDH
VLVNDDLESTYKQLKVTDHLSC
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
aacgagctttcgactgacgtttatttattggacaccatcaacaatcgatggactgctcca
aagattttaggaaccccgccctgtccacgggatgggttctcgtgtctgacactggaaaag
gacaggttgcttgtttacgatgacaaggataactggcttctaaagatcggtacaccacac
ggacgagctggggaggaagtaatttcttggggtaaagccagacgcgacacactgcctatc
gtcatctgtggtccgtccggcgttggcaaaggaactctgatagcgaagctaatgcaagag
ttcccggacaagtttggattctcagtcagtcacacaacaagaaagccgcgagagaaagaa
cttgatggtgtacactaccatttcacaagccgtgatagcatggagcttgctgtcaacgag
gggatgtttctggagcacgccaacgtgcacgggaacatgtatggcactagcatttcagcg
gttgaagcagtctctgatggaggaaagcgatgcatcctggacattgatgtacagggagct
aagtctgtgcgacagagctcgatggaagcattatttatcttcatattgcccccatctttt
gaagagctggaaaagcgtcttcgcgggaggggaacggagacagaggaacaagtaatgaag
cggcttcaaaacgcaaagcgagagcttgagctcggtaaagacccctttctctttgaccat
gtcttagtgaacgacgaccttgagtccacctacaagcagctgaaggtaaccgatcatctt
tcttgctaa

DBGET integrated database retrieval system