KEGG   Selaginella moellendorffii: SELMODRAFT_108564Help
Entry
SELMODRAFT_108564 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
smo  Selaginella moellendorffii
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:smo00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 217 aa AA seqDB search
MTQLEEALGTPFDVGPQVPAPKPLVIVISGPSGVGKDSVIKRLQEVRKEIHFVVTATSRQ
KRPGEVHGVDYYFVSKEEFEEMIDKNELLEHALVYGDYKGIPKKQVRDCLAKGKDVVLRV
DVQGAATVRSILGSNAVFIYIVAESEFALVKRLIERKTESMEKLVVRVATARDELKRLEE
FDYAVVNSDGQLERSVNAICGIIDAEKSRVIQKLASI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagctcgaggaggcactggggacgcctttcgatgtcgggcctcaagttccggca
ccaaagcctctggtaattgtcatcagtggcccaagcggtgttggcaaagactctgtcatc
aagaggcttcaagaagtgaggaaggagatacatttcgtggtgaccgccactagcaggcaa
aagcgtcccggagaagttcatggtgtcgactactacttcgtcagcaaggaagagtttgag
gagatgattgacaagaatgagctcttggagcatgcactggtctacggagattataaaggg
attcctaagaaacaagtgcgagattgcttggccaaagggaaggacgtcgttttgagagtt
gacgtccaaggggctgccacagttcgctcgatactcggctccaacgccgttttcatctac
atcgtcgcagagtcggagtttgctctggtgaagagactgatagaaagaaagacggagagc
atggagaagctggtggtgagagtagcaaccgcaagagacgagctcaagagactggaagag
tttgattacgcggtggttaactcggacgggcaactagagagatcagtgaacgccatatgc
gggatcatcgacgcggaaaagtctagagtgattcagaagctggcaagcatctag

DBGET integrated database retrieval system