KEGG   Selaginella moellendorffii: SELMODRAFT_109582Help
Entry
SELMODRAFT_109582 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
smo  Selaginella moellendorffii
Pathway
Inositol phosphate metabolism
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SELMODRAFT_109582
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    SELMODRAFT_109582
Enzymes [BR:smo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     SELMODRAFT_109582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 457 aa AA seqDB search
IQLLGPQFGDPAVRNYAVSVLENLSNEEICSFLVQLVQALHYEPRIESALLQFLVNKASV
DQSLGYYLYWHIKAGLEVAFFAVKLQFAMNEFRKTCKSHVMTALSKQEKLVLSLANIARG
IRQVKQKAERQKQLISLLSELESFESVALPVDPRCEVNGLELTKCKYMDSKKLPLWLVFK
NTDRSVEEHTYIIFKTGDDLRQDILTLEMFSLMNKTWLRHNLDMKMTIYSCVATGDSSGM
LQVVWNSETLSNICKVDISLIASGGGVAVFKEDTLINWLMHETQTGELSRALDNFTRSCA
GYCVATCLLGIGDRHNDNIMLKRNGQFFHIDFGHILGHFKSKFGIKRERARFVLTPDMAF
VMGGTHDPRFRSFEILCAQAFNQIRAEATKYLNLMSLMISSGLSEVSSPADVRYMHDIML
LNLSDEHAAKEFTKWIHDSLHTKSTQFNHAIHTWVHK
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atacagctacttggtccgcaatttggagatcctgctgttcgtaactacgcagtctctgta
ctggaaaacctttcgaatgaggagatctgctctttcttagtgcagctagttcaggcatta
cattacgagccacggatagagtccgctcttttgcaattcctcgtcaacaaagcttcggtg
gaccaatcgctcggttactatttgtactggcacatcaaggccggcttggaggttgccttc
ttcgcagtgaagcttcagtttgcaatgaatgagttccgaaagacttgtaagtcacacgtt
atgacagctctctcgaagcaagagaagctggtactctcattagccaacattgctcgtggt
ataaggcaagtcaaacagaaggccgagcgtcagaagcaacttatctctttgctttcggag
ctcgaatcttttgaaagcgtcgcgttgccggtagatcccaggtgtgaggtcaatggcttg
gaactgacgaaatgcaagtacatggattcgaaaaagcttcctctctggctggtattcaag
aacacggaccgtagtgtggaagagcacacttacattattttcaagactggcgacgacctt
cgtcaagacatacttacgctggaaatgtttagcctcatgaacaagacatggcttaggcac
aacctggatatgaaaatgacaatctacagttgcgtcgctaccggcgatagtagtggaatg
ctacaagtcgtctggaactcggagactttatccaacatctgcaaggtagacattagtttg
attgcttctggcggaggagtggctgtcttcaaagaggatactcttatcaactggctcatg
catgaaacgcagactggtgagctctcaagagcactggataacttcacgagatcttgcgct
ggatattgcgttgcaacatgcttgcttgggataggcgatcggcataacgataatatcatg
ctcaagagaaacggccagttttttcatatcgatttcgggcacatcttgggacattttaag
tcgaagtttggcatcaagagggagcgtgcacgcttcgtgctgacgcccgacatggcgttc
gtgatgggtggcacacatgaccctcgtttccggtcgtttgagatactctgtgctcaagcc
ttcaaccaaattcgagcagaggctacaaagtatcttaatctaatgtctctgatgatttct
agcggactgagcgaagtctccagccccgcagacgtccgctacatgcacgacataatgctg
ctcaacctctcggacgaacacgcggccaaagagttcacgaaatggatccacgacagcctc
cacacgaaatccacccagttcaaccacgcaatccacacttgggtccacaaataa

DBGET integrated database retrieval system