KEGG   Selaginella moellendorffii: SELMODRAFT_109806Help
Entry
SELMODRAFT_109806 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
Organism
smo  Selaginella moellendorffii
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 316 aa AA seqDB search
MGVVAPGFPEFVANPRRNAGFSPGNISSRSCRWIHSTRFVRSSVAPSIGARDPEASYETI
TAEVVESKSVGLLMLNRPQVLNALSEVCMREVVAALKGFDALPEVGAIVISGKGKAFAAG
VDIKELKNKTMVDSFVNPVLDQWNQVSRIRKPLIAAVNGYALGGGCELAMMCDIILVGEK
AVFGQPEIKIGTIPGMGGTQRLIREVGKSRAMEMILTGERFMDAKEACQRGLASRVIEGT
NEELVAEAVAMAKNISGMSRPAVIMAKAAVNAAYESHLEEGVKREQAFFGATFGLEDRSE
GMAAFFEKRKPNFQNK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtagtggctcctggttttccagaattcgtcgcgaatcctcgccgcaatgcgggt
ttttctccaggaaatatttcttccaggagctgccgctggattcactcgactcgcttcgtg
agatccagcgttgctccatcgattggcgctcgtgatccagaggcaagctatgagacgatc
actgccgaggtcgtggagagcaagagcgtgggtctcttgatgctcaacaggccccaggtt
ctcaatgcgctctccgaggtttgcatgagagaggttgtcgcggccttgaaaggattcgat
gccctgccagaggttggagcgattgtcatctccggtaaaggcaaagcgttcgctgccggc
gtggacatcaaagagctcaagaacaagactatggtggattcatttgtgaatcctgttctt
gatcagtggaaccaagtttccaggattcgaaagccactcatcgctgcagtgaacggatat
gctcttggtggtggctgcgagcttgcaatgatgtgtgatatcatcctggtgggcgagaag
gccgtgtttgggcagccagagattaaaatcgggacgatcccaggcatgggcggaacccag
cgcttgatccgagaggtcggcaagtcgcgagcaatggagatgatactcacgggagagcgc
ttcatggatgccaaagaagcgtgccaacgaggtctcgccagccgagtgatcgaaggaaca
aacgaggagctcgtcgccgaggcagtggcgatggccaagaacatctcgggcatgtcacgc
ccagcggtgatcatggccaaagcggctgtgaatgccgcgtatgagagccatctcgaggaa
ggcgtcaagagagagcaagcgttttttggagcaacgtttggcttggaagatcgcagcgaa
ggaatggctgctttcttcgagaaaaggaagccaaacttccaaaacaaatag

DBGET integrated database retrieval system