KEGG   Selaginella moellendorffii: SELMODRAFT_110441Help
Entry
SELMODRAFT_110441 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
smo  Selaginella moellendorffii
Pathway
Tyrosine metabolism
Betalain biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    SELMODRAFT_110441
  Biosynthesis of other secondary metabolites
   00965 Betalain biosynthesis
    SELMODRAFT_110441
Enzymes [BR:smo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     SELMODRAFT_110441
Exosome [BR:smo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SELMODRAFT_110441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 232 aa AA seqDB search
MTSPSTFFRGQVGDGREQRLLEHVVAEAEPGNPKSVLDVIDRYTASKGTWFMNIGDDKGP
ILDSVVERSNPRLALELGAYCGYSAVRIASRMKDPNGLLISIEMNPQNVQIARKMVEIAG
LSDRVRVLEGTLESCLAELKSIIRDELQLSAIDLVFIDHNKNVYLKDYLQLKEEGLLKSG
SVIVADNMGFPGSPSFWRYLKKNAQELHTVEHRCKFEYIGWISDIVTVSTCV
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcccgagtaccttcttccggggccaggtgggcgatgggcgagagcagcggctc
ctcgagcacgtagtcgcagaggccgagccagggaatcccaaatccgtgctggatgtaatc
gatcgctacaccgcatccaaggggacgtggttcatgaacatcggcgacgacaaaggcccc
attctcgactcggttgtggagcgctccaatccccggctcgcgctggagctgggtgcttac
tgcggctactcggcagtgagaatcgcgtcgcggatgaaagatccaaatgggctgctgatc
agcattgagatgaatccccagaacgtccagatcgcgaggaaaatggtggagattgcaggt
ctgtctgatagggtccgcgttctcgagggcacgctcgagagttgccttgcggagctcaaa
tcgatcatccgcgacgagctccagctgagcgccatcgatctggtcttcatcgatcacaac
aagaacgtctatctcaaggattatctccagctcaaggaagaggggctgctcaagagtggc
agcgtaatcgtggcggacaatatgggcttccctggatcgcccagcttctggcgatacctc
aagaagaacgcgcaggagctccacaccgtggagcaccgctgcaaattcgagtacattggc
tggatctccgacattgtcacggtttctacttgcgtgtaa

DBGET integrated database retrieval system