KEGG   Selaginella moellendorffii: SELMODRAFT_111454Help
Entry
SELMODRAFT_111454 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
smo  Selaginella moellendorffii
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    SELMODRAFT_111454
Enzymes [BR:smo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     SELMODRAFT_111454
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 574 aa AA seqDB search
MTALPLPPHSGEEAIKVQPLKEADPNVCVAELSDSEDDDADGLFPDTTAAAAAPDNASGS
SDDRIKVTNALSAYEKLRICYVRDKVTGDCSQKAAAALKEKNMWVNRAKRIGPVPGVEVG
DIFFFRIAMCIVGLHRQTQAGIDTIRPNENKFGELIACSLVLSGGYEDDVDGGETFTYTG
QGGNAYHGDKRQYRDQELVKGNLGLANSCKYDVPVRVTRGCLDSKSPSGKIYSYDGLYRV
THFWAEPGMSGFRVFKYSLERDPGQLELGSRIVKFSGKLQAKMEARKAVVCEDISGGRER
VPICAVNDVDAAPGPPPPFTYITKTIFPPGFLQPSYPTGCRCVGRCGDSASCLCIGKNSN
KMPYTDGALYEWKTILYECGPMCRCAASCPLRLSQQGQTRKLEVFKTENRGWGVRSWEAI
PFGSFICEYVGELLSNEEAERRVGQDEYIFDIDCIKGSRSRGVDISSFFEEKDGGEICEV
VEDGHMSIDAGSCGNVSRFINHSCDPNMFVQCVFNDHNDMAYPHVMMFAMKNIRPFEELS
YDYGYEIDSVRDSDGKIKKKRCYCGARRCKKRLY
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgctccctcttcctcctcactccggcgaggaagccatcaaggtccagccactc
aaggaggcggatccaaacgtttgcgtggcggagctctcggactccgaggacgacgacgcc
gacgggctcttcccggacaccaccgccgccgccgccgccccggacaacgccagcggcagc
agcgatgaccgtatcaaggtgaccaacgcactttcggcgtacgagaagctccggatatgc
tacgtgcgcgacaaggtgacgggcgactgctcgcaaaaggcggccgctgccctgaaggag
aagaacatgtgggtgaaccgagcgaaacgtatcggcccggttcccggggtggaagttggc
gacatcttcttcttccggatcgcgatgtgcatcgtcggcctccaccgccagacccaggcc
ggcatcgacaccatccggcccaacgagaacaagtttggcgagctcatcgcttgcagcttg
gttctctcgggcggatacgaggacgacgtcgacggtggcgagacattcacgtacacgggc
cagggagggaacgcctaccacggcgacaagcggcagtaccgcgaccaggagctcgtcaag
gggaacttgggccttgccaacagctgcaagtacgacgtccccgttcgagtcacccgcggc
tgcctggattccaagagcccctcggggaagatctacagctacgacggtctctacagggtc
acccacttctgggccgagcccggcatgtcggggttccgggtgtttaagtacagcctcgag
cgcgacccagggcagctggagctgggttccaggatcgtcaagttctccgggaagctccag
gcgaagatggaggctcgcaaggcggtggtgtgcgaggacatctccggagggcgagagcgg
gttccaatctgtgccgtgaacgacgtcgacgcggccccggggccgccgccacctttcacc
tacatcaccaagaccatctttccgccgggcttcctccagccgtcgtacccgacggggtgc
cgctgcgtggggcggtgcggggactctgccagctgcctgtgcatcgggaagaacagcaac
aagatgccatacacggacggggcgctgtacgagtggaagacgatcctgtacgagtgtgga
ccgatgtgccgctgcgcggcgagctgcccgctgcgactctcccagcaaggccagacgagg
aagctcgaggttttcaagacggagaaccgggggtggggggtgcgctcctgggaggccatc
ccgttcgggagcttcatctgcgagtacgttggcgagctgttaagcaacgaggaggccgag
cggcgagtcgggcaggacgagtacatcttcgacatcgattgcatcaaagggagccgctcc
cgcggggtggacatatccagcttcttcgaggagaaggatggaggggagatttgcgaggtg
gtggaggatggtcatatgtccatcgacgctgggagctgcgggaacgtttccaggtttata
aaccatagctgcgaccccaacatgttcgtccagtgcgtcttcaacgaccacaacgacatg
gcgtacccgcacgttatgatgttcgccatgaagaacatccggcctttcgaggagctgtcc
tacgactatggctacgagatcgactcggtgagggacagcgacgggaagatcaagaagaag
cggtgctactgcggggctcgaaggtgtaagaagcgactctattaa

DBGET integrated database retrieval system