KEGG   Selaginella moellendorffii: SELMODRAFT_111780Help
Entry
SELMODRAFT_111780 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
smo  Selaginella moellendorffii
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:smo00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 443 aa AA seqDB search
MLGNFDSLREISRNARGWSVGSLACPRARSWRPSAVSSETTGNIDSRAQPRPQCLEHNRD
GNDKKITRGVYAQELEVAARAVQLGCMLAQRVQERILRKEENAGSKDDKSLVTVADWGVQ
AVVSWVLSQAFGEEVSIIAEEDTKGLKGMNGIQTLQRVVAVVNECLSQASVVGLTPPSRK
LGTIEVLRAINKGNSEVRSSRSWVLDPVDGTLGFVRGDQYAIALGMIEDGRVVLGVLGCP
NYPMRPQWLNYHQKYYRLASKIAPPPPGKWHKGCVLTSAKGAGQAWMEPLVWNSDGSFLL
NPPRVVAVSPVDDPAQATFCEPVEKANSSHSFTEGVADSLGLRKRPLRVYSMAKYAAIAR
GDAEIFMKFARAGYKEKIWDHAAGVLIVEEAGGVVTDAGGRPLDFSKGRYVEGLDRGIIV
SCGTGLHRRIISAVDASWNSSKL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgctcggaaatttcgattctttgcgcgagatttcaagaaatgcgcgtggctggagtgta
ggatctctcgcgtgtcccagggcgcggagctggcgaccgagcgctgtgtcgagcgagact
actgggaatatcgattccagagcgcagccacggccgcaatgcttagaacacaatcgcgat
ggtaatgacaagaaaatcacaaggggagtttatgcccaagaactggaagtggctgctcga
gctgtgcagctgggttgtatgctcgcgcagcgtgtccaggagagaattctccggaaagaa
gagaatgccggttccaaggacgataaatcgctcgtgacagtcgcagactggggagtccaa
gcagtcgttagctgggtgctctcccaagcttttggagaggaggtatcgatcatagccgag
gaagacacgaaaggcctgaaaggaatgaatggaatccagacgctccagcgggtcgtagca
gtggtgaatgagtgcctgtcccaagcctcggtggtcggtctcactcctccatcgcgcaag
ctcgggacgatcgaggtgctccgagctatcaacaaaggaaactcggaagttcgctccagc
aggagctgggtcttggatcccgtggatggaactcttggattcgtgcgtggggatcagtat
gccattgctctggggatgatcgaagatggaagagttgtcctgggagttctcggctgcccg
aattatccgatgagaccgcagtggctgaactatcatcagaagtactaccgacttgccagt
aagatcgcaccaccaccaccgggaaaatggcacaaaggctgtgttcttacctctgcaaaa
ggagctggacaggcatggatggagcccctggtttggaactcggatggctctttcttgctg
aatcctccccgagtggtagcagtctctccggtggatgatccagcgcaagctactttctgc
gagcctgtcgagaaggccaactcaagccattcattcacggaaggagttgctgacagcctt
ggcctgaggaaacgtccgttacgggtctacagtatggcgaagtatgcagcaattgctcgt
ggcgacgcggagatcttcatgaaattcgcaagagcgggttacaaggagaagatctgggat
cacgctgccggagtgttgatagtggaggaagccgggggagtggtaactgacgctggcggt
cggcctctagatttttcaaagggacggtatgtagaagggctggacagggggatcatcgtg
agctgcgggacgggcctacacaggagaattatctcagcagtggacgcgagctggaattcg
tccaagctgtga

DBGET integrated database retrieval system