KEGG   Selaginella moellendorffii: SELMODRAFT_112569Help
Entry
SELMODRAFT_112569 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
smo  Selaginella moellendorffii
Pathway
smo00052  Galactose metabolism
smo00561  Glycerolipid metabolism
smo00600  Sphingolipid metabolism
smo00603  Glycosphingolipid biosynthesis - globo and isoglobo series
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SELMODRAFT_112569
  Lipid metabolism
   00561 Glycerolipid metabolism
    SELMODRAFT_112569
   00600 Sphingolipid metabolism
    SELMODRAFT_112569
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    SELMODRAFT_112569
Enzymes [BR:smo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SELMODRAFT_112569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Melibiase_2 Melibiase Melibiase_2_C Raffinose_syn
Motif
Other DBs
NCBI-GeneID: 9647896
NCBI-ProteinID: XP_002980405
JGI: 112569
UniProt: D8SAW9
Position
Unknown
AA seq 391 aa AA seqDB search
MAAKNYLVLLVLLLTDLVRSSDSFERHRLLENGLGRTPPMGWNSWNYFHCGINEEIIRAT
ADAIVSTGLRDVGYEYVNIDDCWAELSRDNEGNLQARNSTFPSGIKALADYVHSKNLKFG
IYSDAGYLTCQEQPGSLNHEDQDAKTFAAWGVDYLKYDNCHTDGSSPRIRYPIMRDALSA
AGRPIFFSMCEWGQEDPATWASSVGNSWRTTGDIQNKWESMISIADKNNAWAEHAAPGGW
NDPDMLEIGNGGMSFQESRTHFSLWALMKAPLIIGCDVRNIAAQDLAILMNKEVIQINQD
ALGVQGRKVAGDGEQEVWGGPLSNGRFALLMLNRGSDPADITAEFAALGIPSNVSVMIRD
VWKLPGTGTYNSSITSRVESHDVAMYILTPV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggccgccaagaattatctcgtgttgctggtgctgcttctcacggatctcgttcgatcc
agcgattcttttgagcgtcaccggctgctggagaatgggctgggaagaacaccgccaatg
ggatggaatagctggaattacttccactgtggaatcaacgaggagatcattcgagcaacc
gctgatgcgattgtgtctactggcctcagagatgttggctacgagtatgtaaacattgat
gattgctgggcggagctttcacgagacaatgagggaaaccttcaagcacggaactccaca
ttcccgtcaggaatcaaagccttggctgactacgtgcattctaagaacctcaagtttggg
atttactcggacgctggatacttgacgtgccaggaacagccaggatctttgaatcacgaa
gatcaagacgccaaaacttttgctgcatggggagtggattacttgaagtatgacaattgt
cacaccgatggaagctcaccgagaatccgataccccataatgcgcgacgctcttagtgcg
gcaggccggccgattttcttctcaatgtgtgaatggggtcaggaagatccagcaacatgg
gcatcgagcgtcggaaatagctggagaacaaccggggatatacagaacaaatgggaatcg
atgatttctatcgcggacaagaacaatgcgtgggccgagcacgccgctccgggcggatgg
aatgatccggacatgctggagatcggcaatggcggcatgagcttccaggaatcgcgcacg
cacttcagcttgtgggcgctcatgaaagcaccgttgattattggttgcgacgtacggaac
attgcggcccaggacctggccattctcatgaacaaagaggtgatccaaatcaaccaagat
gcgctaggggttcaaggaagaaaggtggcgggagatggagaacaagaggtgtggggaggc
ccgctctcaaacgggagatttgcgctcttgatgctcaatcgaggcagtgatccagctgat
atcacagccgaatttgctgcgcttggcattcctagtaacgtttcagtgatgatccgcgat
gtttggaagcttccaggcacgggcacgtataattccagtattacatccagagttgaatcg
cacgatgtagccatgtacatacttactcctgtgtag

DBGET integrated database retrieval system