KEGG   Selaginella moellendorffii: SELMODRAFT_114014Help
Entry
SELMODRAFT_114014 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
smo  Selaginella moellendorffii
Pathway
smo00040  Pentose and glucuronate interconversions
smo01100  Metabolic pathways
Module
smo_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SELMODRAFT_114014
Enzymes [BR:smo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     SELMODRAFT_114014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pectinesterase PMEI Pectate_lyase_3 BrnA_antitoxin DDE_2
Motif
Other DBs
NCBI-GeneID: 9646991
NCBI-ProteinID: XP_002981054
JGI: 114014
UniProt: D8SCR0
Position
Unknown
AA seq 411 aa AA seqDB search
MIGDSLGSSLRNASTSRLNDVHTWVSSALAYQTTCLDGLSQISPGQEVVFQLSQEGSKVG
RRISTALAFIATLQSISPTSGTINDVSWVPELLKKKHKKAVTANVIVAQDGSGRYSTIKQ
AVEAAPSKSGSTYVIYIKAGTYRETVSVPKSKTNLMFVGDGIGKTIITGSKSVSDGVTTF
RTSTVEINARGFLARDLTIRNTAGAAKHQAVALRVSADKVAFYKCSFEGYQDTLYTHVAR
QFYRECIVYGTVDFIFGDAAAVFQSCTLLARKPMAKQKNTITAQGRTDPNQNTGLSFQDC
SVDGTQDLKGSGTPTYLGRPWKKYSRTVFLRCYMGSVVNPAGWLEWDGSFALKTLYYAEY
QSKGPGSGTGNRVGWSSQMSSSVVANKFTAGSFISGSDWLGQTSFPYSLGI
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgatcggagactccctggggagctctctcaggaacgccagcacctcgaggctcaacgac
gttcatacgtgggtcagctcggccctcgcgtaccagacgacatgcttggacggcttgagc
cagatctctcccgggcaggaggtggtatttcagctgagccaagaaggaagtaaagttggg
aggaggataagcactgcactcgcgtttatagcaactttgcaatcgatctcgccgaccagc
ggcacaattaacgacgttagctgggtgccagagcttctaaaaaagaaacacaagaaggcc
gtcactgcgaatgtgatcgttgctcaggacggaagtggacgatactcgactatcaagcag
gccgtggaggctgctcccagcaagagtggcagtacctacgtgatttacatcaaggccggg
acttacagggagacagtttcggtgccaaaatccaagaccaatctcatgtttgttggcgat
gggattgggaagaccatcatcacgggctccaaaagcgttagcgatggagtcacgacattc
aggacatctactgtcgagataaacgcgagaggattccttgccagagacttgacaatccga
aacactgccggggccgccaagcaccaagcagtggctcttcgcgtcagcgctgacaaggtc
gcgttttacaagtgctccttcgagggctaccaggacacactctacactcacgtcgcgcgc
cagttctatcgcgagtgtatcgtctacggaaccgtcgacttcatctttggcgacgccgcg
gccgtgttccagagctgcacgcttctggctcgcaagccgatggcgaagcagaagaacacg
atcaccgcccagggacgcacggatccaaaccaaaacaccggcctcagcttccaggactgt
agcgttgacggcactcaggatctcaagggcagtggaactccaacttatctaggccggcca
tggaagaagtattccaggacagtgttcttgcggtgctacatggggagcgtggtgaatccg
gccgggtggctcgagtgggatggaagttttgcgctcaagacgctctactatgccgagtat
cagagcaaagggccgggatctgggaccgggaatagagttggctggtcgtcacagatgagc
tcgtctgtggtggctaataaattcactgctggaagcttcatctctgggtcggattggctt
ggacagactagttttccctactcgcttgggatatag

DBGET integrated database retrieval system