KEGG   Selaginella moellendorffii: SELMODRAFT_114014Help
Entry
SELMODRAFT_114014 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
smo  Selaginella moellendorffii
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SELMODRAFT_114014
   00500 Starch and sucrose metabolism
    SELMODRAFT_114014
Enzymes [BR:smo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     SELMODRAFT_114014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 411 aa AA seqDB search
MIGDSLGSSLRNASTSRLNDVHTWVSSALAYQTTCLDGLSQISPGQEVVFQLSQEGSKVG
RRISTALAFIATLQSISPTSGTINDVSWVPELLKKKHKKAVTANVIVAQDGSGRYSTIKQ
AVEAAPSKSGSTYVIYIKAGTYRETVSVPKSKTNLMFVGDGIGKTIITGSKSVSDGVTTF
RTSTVEINARGFLARDLTIRNTAGAAKHQAVALRVSADKVAFYKCSFEGYQDTLYTHVAR
QFYRECIVYGTVDFIFGDAAAVFQSCTLLARKPMAKQKNTITAQGRTDPNQNTGLSFQDC
SVDGTQDLKGSGTPTYLGRPWKKYSRTVFLRCYMGSVVNPAGWLEWDGSFALKTLYYAEY
QSKGPGSGTGNRVGWSSQMSSSVVANKFTAGSFISGSDWLGQTSFPYSLGI
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgatcggagactccctggggagctctctcaggaacgccagcacctcgaggctcaacgac
gttcatacgtgggtcagctcggccctcgcgtaccagacgacatgcttggacggcttgagc
cagatctctcccgggcaggaggtggtatttcagctgagccaagaaggaagtaaagttggg
aggaggataagcactgcactcgcgtttatagcaactttgcaatcgatctcgccgaccagc
ggcacaattaacgacgttagctgggtgccagagcttctaaaaaagaaacacaagaaggcc
gtcactgcgaatgtgatcgttgctcaggacggaagtggacgatactcgactatcaagcag
gccgtggaggctgctcccagcaagagtggcagtacctacgtgatttacatcaaggccggg
acttacagggagacagtttcggtgccaaaatccaagaccaatctcatgtttgttggcgat
gggattgggaagaccatcatcacgggctccaaaagcgttagcgatggagtcacgacattc
aggacatctactgtcgagataaacgcgagaggattccttgccagagacttgacaatccga
aacactgccggggccgccaagcaccaagcagtggctcttcgcgtcagcgctgacaaggtc
gcgttttacaagtgctccttcgagggctaccaggacacactctacactcacgtcgcgcgc
cagttctatcgcgagtgtatcgtctacggaaccgtcgacttcatctttggcgacgccgcg
gccgtgttccagagctgcacgcttctggctcgcaagccgatggcgaagcagaagaacacg
atcaccgcccagggacgcacggatccaaaccaaaacaccggcctcagcttccaggactgt
agcgttgacggcactcaggatctcaagggcagtggaactccaacttatctaggccggcca
tggaagaagtattccaggacagtgttcttgcggtgctacatggggagcgtggtgaatccg
gccgggtggctcgagtgggatggaagttttgcgctcaagacgctctactatgccgagtat
cagagcaaagggccgggatctgggaccgggaatagagttggctggtcgtcacagatgagc
tcgtctgtggtggctaataaattcactgctggaagcttcatctctgggtcggattggctt
ggacagactagttttccctactcgcttgggatatag

  All links  
No link information was found.   
DBGET integrated database retrieval system