KEGG   Selaginella moellendorffii: SELMODRAFT_116387Help
Entry
SELMODRAFT_116387 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K06129  lysophospholipase III [EC:3.1.1.5]
Organism
smo  Selaginella moellendorffii
Pathway
smo00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SELMODRAFT_116387
Enzymes [BR:smo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SELMODRAFT_116387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LCAT Hydrolase_4 Abhydrolase_6 PGAP1 DUF676 Ser_hydrolase SpoVIF
Motif
Other DBs
NCBI-GeneID: 9660861
NCBI-ProteinID: XP_002982367
JGI: 116387
UniProt: D8SG32
Position
Unknown
AA seq 420 aa AA seqDB search
MALSFQIAASAATTPPSSSLSSSWKPRLSPVILVPGAGGNQLEVKLGGDYHGSRFVCRTF
GFSHWFRLWLNVLGIIPPFTPCFAERIRLEYNGGSKTFHNPPGITTRVPGFGSTETMEYL
DPTFKFLSGYMNSLVAALKAKGYESQKTLFGAPYDFRYAPGPNAAEVALQFLHDLKNLVE
KASRSNKNTPVTLISHSLGGLWVLHFLNLQSSTWKKRFIHRFIAVSAPWGGSVQEMRVFA
SGYTEGANFLDPLVLRDEQRSSESNLWLLPSPKVFGNKTLVVGSSRNYTAMDLEDFFRDI
GYSRGYEHYETRVPGLLEELAAPGVPVSLVFGVGVDTPETLVYEKQGFDYQPKMEYGDGD
GTINLCSLRWVVDSWKKVGDQQVKVVELQGKTHTTVLKDEDAVEEIVKQLGDVEGQNLSS
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggctctctccttccagatcgctgcctcggcggctacaactcctccaagttcttcgctt
tcctcttcttggaaacctaggctctctccggtgatcttggtgcctggagctggagggaac
cagctggaagttaagcttggtggagattatcatggtagtcgctttgtgtgtaggactttt
gggttctcgcattggttccggctatggctcaatgttcttggcatcattcctccattcacg
ccatgctttgccgagaggataaggctcgagtacaatggcgggagtaagacgtttcacaat
cctcccgggatcacgaccagagttcctgggtttggttccaccgagacgatggagtacctc
gatccaaccttcaagtttctatctggctacatgaactctttggtggcagcactgaaagcc
aaaggctacgagtcccagaaaactctctttggagctccatacgattttcggtacgctccg
ggcccaaacgcagcggaagtggcactccagttcctccacgacttgaaaaacttggtggag
aaagcctcgagatcaaacaagaacacgccagtgacgctaatctctcacagcctcggtggt
ctctgggtgctccacttcctcaacttacagagctccacctggaagaagagattcatccat
cgcttcatcgcagtgtcagctccatggggtggctccgtccaagagatgcgagtctttgcc
tctggatacaccgaaggggccaactttctggatcctctcgtgctgcgagacgagcaaagg
agcagcgagagcaacctttggctgctgccatcgcccaaagtttttggaaacaagacgctg
gtggtgggatcgtcaaggaattacacggcgatggatctggaggacttcttccgcgatatt
ggctactcgaggggatatgagcactacgagacgagagttcccggactcttggaagaactg
gctgctccaggggttccagtgagcctggtttttggcgttggagtggacacaccagagact
ctggtgtatgagaaacagggatttgattaccagcccaagatggagtatggagatggagac
gggacgatcaacttgtgcagcttgagatgggtggtggattcgtggaaaaaagtcggggac
caacaagtaaaggtggtggaacttcaagggaagacacacacgacggttttgaaggacgag
gatgcagtggaagagattgtcaaacaattaggtgatgtcgaaggacaaaacttaagttca
tag

DBGET integrated database retrieval system