KEGG   Selaginella moellendorffii: SELMODRAFT_116387Help
Entry
SELMODRAFT_116387 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
smo  Selaginella moellendorffii
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:smo00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 420 aa AA seqDB search
MALSFQIAASAATTPPSSSLSSSWKPRLSPVILVPGAGGNQLEVKLGGDYHGSRFVCRTF
GFSHWFRLWLNVLGIIPPFTPCFAERIRLEYNGGSKTFHNPPGITTRVPGFGSTETMEYL
DPTFKFLSGYMNSLVAALKAKGYESQKTLFGAPYDFRYAPGPNAAEVALQFLHDLKNLVE
KASRSNKNTPVTLISHSLGGLWVLHFLNLQSSTWKKRFIHRFIAVSAPWGGSVQEMRVFA
SGYTEGANFLDPLVLRDEQRSSESNLWLLPSPKVFGNKTLVVGSSRNYTAMDLEDFFRDI
GYSRGYEHYETRVPGLLEELAAPGVPVSLVFGVGVDTPETLVYEKQGFDYQPKMEYGDGD
GTINLCSLRWVVDSWKKVGDQQVKVVELQGKTHTTVLKDEDAVEEIVKQLGDVEGQNLSS
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggctctctccttccagatcgctgcctcggcggctacaactcctccaagttcttcgctt
tcctcttcttggaaacctaggctctctccggtgatcttggtgcctggagctggagggaac
cagctggaagttaagcttggtggagattatcatggtagtcgctttgtgtgtaggactttt
gggttctcgcattggttccggctatggctcaatgttcttggcatcattcctccattcacg
ccatgctttgccgagaggataaggctcgagtacaatggcgggagtaagacgtttcacaat
cctcccgggatcacgaccagagttcctgggtttggttccaccgagacgatggagtacctc
gatccaaccttcaagtttctatctggctacatgaactctttggtggcagcactgaaagcc
aaaggctacgagtcccagaaaactctctttggagctccatacgattttcggtacgctccg
ggcccaaacgcagcggaagtggcactccagttcctccacgacttgaaaaacttggtggag
aaagcctcgagatcaaacaagaacacgccagtgacgctaatctctcacagcctcggtggt
ctctgggtgctccacttcctcaacttacagagctccacctggaagaagagattcatccat
cgcttcatcgcagtgtcagctccatggggtggctccgtccaagagatgcgagtctttgcc
tctggatacaccgaaggggccaactttctggatcctctcgtgctgcgagacgagcaaagg
agcagcgagagcaacctttggctgctgccatcgcccaaagtttttggaaacaagacgctg
gtggtgggatcgtcaaggaattacacggcgatggatctggaggacttcttccgcgatatt
ggctactcgaggggatatgagcactacgagacgagagttcccggactcttggaagaactg
gctgctccaggggttccagtgagcctggtttttggcgttggagtggacacaccagagact
ctggtgtatgagaaacagggatttgattaccagcccaagatggagtatggagatggagac
gggacgatcaacttgtgcagcttgagatgggtggtggattcgtggaaaaaagtcggggac
caacaagtaaaggtggtggaacttcaagggaagacacacacgacggttttgaaggacgag
gatgcagtggaagagattgtcaaacaattaggtgatgtcgaaggacaaaacttaagttca
tag

DBGET integrated database retrieval system