KEGG   Selaginella moellendorffii: SELMODRAFT_119068Help
Entry
SELMODRAFT_119068 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K03259  translation initiation factor 4E
Organism
smo  Selaginella moellendorffii
Pathway
smo03013  RNA transport
Module
smo_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:smo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SELMODRAFT_119068
Messenger RNA biogenesis [BR:smo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     SELMODRAFT_119068
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     SELMODRAFT_119068
Translation factors [BR:smo03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    SELMODRAFT_119068
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 9643981
NCBI-ProteinID: XP_002983741
JGI: 119068
UniProt: D8SJX5
Position
Unknown
AA seq 203 aa AA seqDB search
MPVDASEREEGEIVASPKSIVKEKHPLEHSWTFWFDNPSGKNKQQQWGSSLRPVYTVSTV
EDFWCLYNNLVQPGRLISGADFHCFKEGIKPEWEDPRCANGGKWTAAPPRGSKQALDQFW
LNTLLALIGEQFDEADEICGVVVSVRPRGDKLSLWTKTANNEAAQMSIGRQWKEFLEYQD
RINFMFHEDAKRGDSKARNRYSV
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgccggtggatgcgagcgagcgtgaggagggggaaatcgtggcgtcccccaaatccatc
gtcaaggagaagcatccgctggagcactcgtggacgttttggttcgataaccctagcggt
aagaacaagcagcagcagtggggaagctcattgcggccggtctacaccgtgagcactgtc
gaggatttctggtgtctctacaataatctcgtgcagccgggtcgattgatcagtggggcg
gactttcactgcttcaaggagggaatcaagcccgagtgggaagatccgaggtgtgcgaat
ggggggaaatggactgctgctccaccgcgaggtagcaagcaagcgctggatcagttctgg
ctaaacactctgctcgctttgatcggtgagcaattcgatgaggctgatgagatctgtggc
gtggtggtgagcgtgaggccgagaggagataagctctccttatggaccaagacggctaac
aacgaagccgctcagatgagcattggaaggcaatggaaggaatttctcgagtaccaggac
aggatcaacttcatgtttcacgaggatgcaaagcgtggtgattcgaaggcgagaaatcgc
tactctgtatga

DBGET integrated database retrieval system