KEGG   Selaginella moellendorffii: SELMODRAFT_120879Help
Entry
SELMODRAFT_120879 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
smo  Selaginella moellendorffii
Brite
Enzymes [BR:smo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SELMODRAFT_120879
Peptidases [BR:smo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SELMODRAFT_120879
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 245 aa AA seqDB search
RQEDAPEFLCFLLNQIHEELLKLDGRTVSEVGVAVDDEWETVGPKNRTARVRTCSRIWSP
LTDIFCGQLYNNVKPKGSKASIQVEPFYVLTLDISSGTVHSVEDALKVCQVLTREGVGRY
RLLLYFAFQDSSRGTKVVSLPKVLILQLLRFGYGNSGTRKVSRAIDFSEQLTVGKELLSP
GNEATSRYELIASIMHHGKDVTSGHYTADAKYGDSWLRFDDRMVDKVSVDMVLNKQAYVL
FYRKL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
aggcaggaggatgcgccagagttcctctgcttcctgttgaatcaaattcacgaggagctt
cttaaactggatggtcgaactgtttccgaggtgggtgttgctgttgacgacgagtgggag
acagtgggtccgaaaaatcgaactgctcgagtccggacatgcagtcgcatttggtcgcct
ctcaccgacattttttgtggacagttgtacaacaatgtcaagccaaaaggttccaaggcc
agtatacaggtcgaaccgttctacgtgttgacgctggatatcagttcaggaacagttcat
tccgtggaggacgctttgaaggtttgtcaagttctcaccagggaaggtgtgggaaggtac
cgactccttttatattttgcattccaggactctagcagaggcaccaaggtggtatcgctg
ccgaaggtactcatcctgcagctgctgcgctttggctatgggaacagtggaacgcgtaag
gtttccagagctatcgatttctccgagcagcttacggtcggcaaagagctcttgtctcca
ggcaacgaggccacttcgaggtacgagttgatagcaagcataatgcaccacggcaaagac
gtgacaagcgggcactacacagccgatgcgaagtacggcgattcgtggctccgattcgac
gaccggatggttgacaaggtgagcgtggacatggtcttgaacaagcaggcgtatgttctc
ttctaccgaaagctttag

DBGET integrated database retrieval system