KEGG   Selaginella moellendorffii: SELMODRAFT_121159Help
Entry
SELMODRAFT_121159 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K03144  transcription initiation factor TFIIH subunit 4
Organism
smo  Selaginella moellendorffii
Pathway
smo03022  Basal transcription factors
smo03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:smo00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    SELMODRAFT_121159
  Replication and repair
   03420 Nucleotide excision repair
    SELMODRAFT_121159
Transcription machinery [BR:smo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     SELMODRAFT_121159
DNA repair and recombination proteins [BR:smo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     SELMODRAFT_121159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tfb2 Helicase_C_3
Motif
Other DBs
NCBI-GeneID: 9645115
NCBI-ProteinID: XP_002984780
JGI: 121159
UniProt: D8SN94
Position
Unknown
AA seq 459 aa AA seqDB search
MPNVRRATRDFMDLVASCLTAARIDALYASKWTCQAVLRSLPPLAKLYVLRLLYLDAAVP
DKMLLEWIKGDAVAKHKNAVDRLVQLRVFLPEEKILSRKKETHYRVNPKFQEQLRLALST
GLGTPRDPLPPDIAVRMPSAKELDDYATEKWEAWFSSLVNFASPDGPSASTNGFIVQLFQ
KADLLTSGQDPKITPAGFQFLLLDRNSQLWRVIREYVQYAEARQIDTGELIRFLLEIGFY
SVGEPYSMDSLPNSQRNFAEELAMLGVLQLQKGMKDRWFIPTRLATGLSASLSESSAWQT
EGFIMVETNFRVYAYTSSKLHIETLHVFVRTEYVLPNILVGSITKESVNGAFASGISADQ
IIKFLQQHAHPFVAQKVPSVPETVCDQIRLWESDRVRVQYLPAYCYEGFPSTSVYESVVA
HARDRNGLLWEDANRKMIVVGGEHHEAIRAFLQNINKKK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgccgaatgtgcggagggcgacgcgcgatttcatggatttggtcgcatcctgcctcacc
gccgccaggatcgacgcgctctacgccagcaaatggacttgccaggcggtcttgagatcg
ctgccgccattggcgaagctctacgtgttgcgattgctctacctggatgccgcggttccg
gacaagatgctgctggaatggatcaagggagacgctgttgccaagcacaaaaatgcggtg
gacaggctagtccagctcagagttttccttccagaagagaaaatcctttccaggaagaaa
gaaacacactacagagttaatcccaagtttcaggagcaactacgactggcattgtctact
ggtttaggaactcccagggaccccttgcctccagacatcgccgtgaggatgccgtccgcg
aaggagctggacgactatgcgactgaaaaatgggaggcatggttttcaagcctcgtcaac
tttgcctctccggatggcccatccgcatcgaccaacggattcatcgtccagctcttccaa
aaggccgatttgcttacttcaggccaggatcctaaaatcactccagctggctttcagttc
cttttgctggataggaactctcagctttggagagtgatccgagagtacgttcaatatgca
gaggctcgtcaaatagacactggagagctaatccgcttccttttggagattggattctac
agcgtcggcgagccatatagcatggattcacttccaaacagccaacgcaatttcgcggag
gagctcgcaatgctcggggtgttgcagctccaaaagggtatgaaagatcgatggttcatt
ccaacgagactcgctactggtctttcagcgagtttgtctgaatcatcagcatggcaaacg
gagggatttatcatggtggaaacgaacttcagagtctacgcgtacacgtcttcgaagctt
catatcgagacgctccatgtttttgtcaggaccgagtacgttcttccaaacattcttgtc
gggagcatcacaaaggagagtgtcaacggcgcgtttgcgagtggaatatctgcagaccag
attatcaaatttctccagcagcacgctcatccgtttgtagctcaaaaagttccttcggtt
ccagagactgtttgcgaccagattcgtctgtgggaatcggaccgcgtgagagtgcaatat
cttcccgcgtactgctacgaaggcttcccaagcacgtctgtttacgagtcagtggtggct
cacgccagggatcgaaatgggcttttgtgggaggacgctaacaggaaaatgatcgtcgtg
ggtggcgaacaccatgaagccattcgagccttccttcaaaacatcaacaagaaaaaataa

DBGET integrated database retrieval system