KEGG   Selaginella moellendorffii: SELMODRAFT_121820Help
Entry
SELMODRAFT_121820 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
smo  Selaginella moellendorffii
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SELMODRAFT_121820
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SELMODRAFT_121820
Enzymes [BR:smo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     SELMODRAFT_121820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 983 aa AA seqDB search
SMFHGRRHSWPLYDYVPKSTLQLLENDPGAPPAHAWRRKLNCHANFLTEFRVTFTEALKL
VLGLGLRLWKFIQAERSQGRTPPIDPFKRGTKPSACHGVPLGGMGGGSIGRGFRGEFRRW
QLLPSVTSEAAVLANQFSVFVTRDKDHGEKKKIASVLSPRPSELDVGKKAQSPEICAWDW
NLDGQNSTYHGLFPRAWTIYDGEPDPDLKISCRQVSPFIPHDYRESSLPVCVFSYVIVNT
GKESASVSLLFTWANSVGGDTHLSGGHSNKPFLEDDGVAGVVLHHRTAKGQPSVEFAIAA
RQNADVAVSVCPSFLVSGKGSTMTAKEMWNQMREKGCFDTDTVCEPSLPSLVNSSLGAAV
SASVTIAPHGKKVVDFALSWDIPEVKFPKGRSYHRRYTQFYGSYGDAAPRLVHDALLNYP
KWEAEIEKWQEPVLKDANLPEWYKFTLFNELYYLVAGGTVWTAFVTPSFRSNGFTSRTNS
ESSITGAVEELVEMIPLNGGTSGNGGVDAILSETEEEIAEKLVKAMEAAILDKQINSAPR
DFPYGTYLLEDGEENVGQFLYLESVEYVMWCTYDVHFYASFALISLFPKLELSIQRDYAA
ATLSHNPELVKFLAGGKWGIKKVLGAVPHDLGIHDPWVEVNAYNIHDTSRWKDLNSKFVL
QIYRDVVATEDLNFARVTWPAVYTAMAYMDRFDRDRDGMIENDGFPDQTYDTWTVHGISA
YCGGLWLAALQAAAAMAEKVNEPNAANYFLRKFRDARKVYDKKLWNGSYFNYDSGSSSNS
NSIQADQMAGQWYAWASGLPPLFDDYKARSALQRIYDYNVMKVKGGKLGAVNGMHPNGRV
DETAMQSREIWSGVTYAAAAAMIHEGMLEQAFTTAEGIYNAGWSDSGYGYWFQTPEAWTT
DGHFRALTYMRPLAIWAMQWALYPPNCVAAGPRIPSKEESAGGSTSSSYLYAGFAKVSEA
LTNVPPQIEQIRSLFHRLCCCCC
NT seq 2952 nt NT seq  +upstreamnt  +downstreamnt
agcatgtttcacggccgaaggcattcctggccgctctacgactatgtccccaagtccaca
ctccagctgctggagaacgatccaggggctcctcccgcacacgcatggaggcgtaagctc
aactgtcacgcaaattttctgaccgagttccgggtgacgttcaccgaggcactcaaactg
gtactcgggctggggctgaggttgtggaagttcatacaagccgagcgctctcagggaaga
acacctccgatcgacccgttcaagcgaggaaccaaaccatccgcttgccacggcgtgcca
cttggtggaatgggtggtggaagcattggaaggggttttcgtggcgaattcaggcggtgg
cagctgttgccttctgtcaccagtgaagctgcagtattagcaaatcaattctcagttttc
gtcactcgggacaaggaccatggagaaaagaaaaagatcgcatctgttctttcgcctcgc
ccctcggagcttgatgtcgggaaaaaggctcaaagtccagaaatctgtgcgtgggactgg
aaccttgacggccaaaattcaacttatcatggcttatttccgcgggcgtggactatttat
gatggcgagccagatccggatttgaagatctcatgccgccaagtctcaccgtttattcct
cacgattatcgagaaagcagcttgccagtctgtgttttctcttacgtgatagtaaacacg
gggaaggaatcggcgagtgttagtctgttatttacctgggcgaattccgttgggggagac
actcacctatccggtggacattctaacaagccttttctcgaggacgatggagttgcaggt
gttgtccttcaccatcgcaccgcgaaaggacagccaagtgtggagtttgcgattgcggcc
cggcaaaacgccgatgtcgctgtttctgtttgtccgagcttcttggtttcgggaaaagga
agcaccatgacggcgaaggaaatgtggaaccaaatgagagagaaaggatgttttgatacg
gatactgtctgtgagccttctcttccttctctcgtaaattcatcacttggagctgctgtg
tctgcttcagttaccattgcaccgcatggaaagaaggttgttgacttcgctctgtcgtgg
gatataccagaagtcaagttcccaaagggcagatcatatcacaggcgctacactcaattt
tatggctcttatggagatgctgctccaagacttgtccacgatgcactcttgaactatcca
aagtgggaggccgaaattgaaaagtggcaggaacctgtgctcaaggacgctaatcttccc
gaatggtataaattcacgctcttcaacgagctttactatttagtcgctggcgggacggtg
tggacagcgtttgtcacaccgtcatttcgatcaaacggtttcacgtctagaacaaacagc
gagagcagtatcactggtgctgtggaagagcttgtggagatgatccccctgaacggagga
actagcgggaacggtggcgtcgatgccattctgtcggagacggaagaggagattgcggag
aagctggtgaaagcgatggaggctgctatattagacaagcagatcaattcggcgccccgc
gatttcccatatggcacgtacttgctcgaggacggggaggagaacgttgggcagttcctc
tacctggagagcgtagagtacgtcatgtggtgcacgtacgatgtgcacttctatgcgtcc
ttcgctctcattagcttgtttcccaagcttgagctgagcatccagcgagattatgcggcc
gcgacactgtctcacaaccctgagctcgtcaagttcctggctgggggcaagtggggtatc
aagaaggtgctaggggcagtgcctcacgacctggggatacacgacccctgggttgaggtg
aacgcgtacaacatccacgacacgagccggtggaaggacctcaactccaagttcgtgctg
cagatatacagggacgtagtggcgacggaggacctcaactttgcgagagtgacatggccg
gccgtgtacactgcaatggcgtacatggacagattcgaccgggacagggacggcatgata
gagaacgatggtttcccagaccagacgtacgatacgtggaccgtgcatggaatcagcgcc
tactgtgggggcctctggctggcggcgttgcaagcagcagcggccatggcggagaaagtg
aacgagcccaacgcggcgaactacttcctcagaaagtttcgtgatgccagaaaagtatac
gacaagaagctgtggaacggttcctacttcaactacgacagcggcagcagcagtaacagc
aactccatccaggccgaccagatggctggccagtggtacgcctgggcgtcgggcttgccc
cccttgtttgacgactacaaggcgcggagtgccctgcagaggatctacgactacaacgtg
atgaaggttaaaggtggcaagctgggtgctgtaaacgggatgcacccaaacggaagggtg
gacgagaccgcgatgcagtcgcgagagatttggagcggtgtcacgtacgcggctgctgcg
gccatgatacacgaggggatgttggagcaggccttcacgaccgcagagggcatctacaat
gctggctggtcagacagcggctacggctactggttccaaactccggaggcctggactacc
gacggccacttccgggcgctcacctacatgaggccgcttgccatatgggccatgcaatgg
gcactctacccgccaaattgtgtcgccgctgggcctcgcatcccgtccaaggaagaatct
gccggcggttccacttcctcgtcctacctctatgcagggtttgcgaaggtgtcggaagcg
ctcacaaacgttccaccgcagattgaacagatccgctcgctctttcatcgcctctgctgc
tgctgctgctaa

DBGET integrated database retrieval system