KEGG   Selaginella moellendorffii: SELMODRAFT_122192Help
Entry
SELMODRAFT_122192 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00943  dTMP kinase [EC:2.7.4.9]
Organism
smo  Selaginella moellendorffii
Pathway
smo00240  Pyrimidine metabolism
smo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SELMODRAFT_122192
Enzymes [BR:smo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.9  dTMP kinase
     SELMODRAFT_122192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thymidylate_kin DUF5430
Motif
Other DBs
NCBI-GeneID: 9649903
NCBI-ProteinID: XP_002985395
JGI: 122192
UniProt: D8SQ47
Position
Unknown
AA seq 229 aa AA seqDB search
MGAEKRGALIVLEGLDRSGKSSQCHRLVEFLKGTGLKVEAWRFPDRTTAIGSSISAYLGG
GAELDDRAVHLLFSANRWEKRLQMERKLMAGTTLVVDRYSYSGVAFSAAKGLDLEWCKAP
EVGLPAADLVLYLDISPEEAAVRGGYGDERYEQLDFQKKVALQYKGLQGKRWKIVDARQS
FDQVHELMRETCVKTVSNCLNGCHHLSWLWTGRLTIAHCFITNSFFLHR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgggagcagagaagcgcggggcgctcattgtcttggagggtctggacagaagcgggaag
agctctcagtgccacaggctggttgagtttttgaagggcactgggctgaaggtggaggct
tggcggtttccagacaggacaactgccatcggtagctcgatttcggcttacttgggaggc
ggggctgagcttgatgatcgtgctgtgcaccttctgttttcagcaaaccgctgggagaag
aggctgcagatggaaaggaaattgatggctgggacaacgttggtagtagatcgatattcg
tactcaggagtggctttctctgctgcgaagggactggatcttgagtggtgcaaggctccc
gaggtcggacttcctgctgcagatctggtcttgtacctagatatttcgccagaggaagct
gctgtgcgcggtggatatggagatgagcgctatgagcagctggattttcagaaaaaagtt
gccttacagtacaaaggtctgcagggtaaaagatggaagattgtggacgcaaggcaatcg
tttgatcaagttcacgagctgatgagagaaacgtgtgtgaaaactgtcagcaattgcctc
aatgggtgccaccatctttcttggctgtggacaggtaggcttaccattgcacattgcttc
atcacaaactctttttttttgcacagatga

DBGET integrated database retrieval system