KEGG   Selaginella moellendorffii: SELMODRAFT_123030Help
Entry
SELMODRAFT_123030 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
smo  Selaginella moellendorffii
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SELMODRAFT_123030
Enzymes [BR:smo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SELMODRAFT_123030
Exosome [BR:smo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SELMODRAFT_123030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 519 aa AA seqDB search
MGDAAAFVAAIDQGTTSTRFILYDQDAKPVASHQLEFEQIYPQAGWVEHDPLEILKSVKV
CMEETLNKAASKGLSFAVKAIGITNQRETSIIWSKSTGKPLYNAIVWMDGRTSSICKRLE
ENLSGGSKHFVESCGLPISTYFSALKLLWLLETVPEVKSAVLAGDALFGTVDSWLIWNMT
GGISGGLHVTDCSNAARTMLMNLKTLSWDKGILESLGISIDLLPHVYNMLPRIISNSEVI
GKVCEGWPLAGVPLAGCLGDQHAAMLGQHCKKGEAKSTYGTGCFILLNTGEEVVPSTHGL
LTTVAYKLGPKAPTCYALEGSIAIAGAAVQWLRDNLGIIKSASEIEALASTVENTGGVYF
VPAFSGLYAPRWRDDARGVCVGITRFTHKGHLARSVLESMCFQAKEVLDSMLKDAKVEHK
EKFVLRVDGGATVNNLLMQIQADLLGTDVVRPKDIETTALGAAYAAGLAVGLWKEEQIFT
ADEEVGQTFTPSIAEPEREKRYTSWCKAVERSYALADLA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatgccgccgcattcgttgccgcgatcgatcaggggacgacgagcacgcgattc
atcctctacgaccaggatgccaagccggtcgcctcgcatcagctggaattcgagcaaatc
tatccccaggccggttgggtggagcatgatcccttggaaatcctcaagtctgtcaaggta
tgcatggaggaaactctcaacaaggccgcgagcaagggtcttagcttcgccgtgaaagct
atcgggatcacgaaccaacgggagacgagcatcatttggagcaagagcactggcaagcca
ctgtacaatgccattgtctggatggatggaagaacgagctccatttgcaaacgcttggaa
gagaatctctccggtggaagcaaacactttgtggaaagctgtggacttcccataagcact
tacttcagtgctttgaagctactgtggctgctagagacggtcccagaggttaagtcggcc
gtgctcgccggggacgctttgttcggcacggtcgatagttggctcatctggaacatgacc
gggggtatctccggaggcttgcacgtcaccgattgctccaacgccgcgagaacaatgctc
atgaatctcaagactttgagctgggacaaaggcatcctcgagagcttggggatctcgatc
gacttgctgcctcacgtctacaacatgcttccccggatcatcagcaactcggaagttatt
ggaaaagtttgcgaggggtggcccctggccggagttccactcgcaggttgcttgggcgat
cagcacgcggcaatgctcggccagcactgcaagaagggagaggccaagagcacttacgga
actggctgcttcatcctgctcaacactggcgaagaagtagtgccttccacgcacgggctt
ctcacgaccgtggcttataagctcgggccaaaggcgccaacttgttacgcgttggaagga
tcgatcgccatcgccggagcagcagtgcagtggctcagagacaaccttgggatcatcaag
agtgcgtcggagatagaagcgctggctagcaccgtggagaacaccgggggagtatacttc
gttccggcgttcagcggcttgtatgctccgagatggagggacgatgcgaggggagtttgc
gtggggatcacgcggttcactcacaagggacatctcgcacggagcgttctggagagtatg
tgtttccaggcgaaggaagtgctcgactcgatgctcaaggacgcaaaggtggagcacaag
gagaagtttgtactgcgcgtcgatggaggagctactgtcaacaatctactgatgcaaatc
caggctgatcttctaggaactgacgtagtgaggcccaaagacattgaaacaacggcttta
ggcgctgcttatgcggctggtttggcagtcggattgtggaaggaagagcagatcttcacg
gccgatgaagaagtcggccagaccttcacgccaagcatcgcggagccggagcgcgaaaag
cgttatacttcgtggtgcaaggccgtggaacgaagctatgcgctcgcagacttggcttaa

DBGET integrated database retrieval system