KEGG   Selaginella moellendorffii: SELMODRAFT_125743Help
Entry
SELMODRAFT_125743 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
smo  Selaginella moellendorffii
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:smo03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 139 aa AA seqDB search
SLYNNLVQPGRLISGADFHCFKEGIKPEWEDPRCANGGKWTAAPPRGSKQALDQFWLNTL
LALIGEQFDEGDEICGVVVSVRPRGDKLSLWTKTANNEAAQMSIGRQWKEFLEYQDKINF
MFHEDAKRGDSKARNRYSV
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
agcctctacaataatctcgtgcagccggggcgattgatcagtggggcggacttccactgc
ttcaaggagggaatcaagcccgagtgggaagatccgaggtgtgcgaatggggggaaatgg
actgcggctccaccgcgaggcagcaagcaagcgctggatcagttctggctaaacactctg
ctggctttgatcggtgagcaattcgatgagggcgatgagatctgtggcgttgtggtgagc
gtgaggccgagaggagataagctctccttgtggaccaagacggccaacaacgaagccgcc
cagatgagcattggaaggcaatggaaggaatttctcgagtatcaggacaagatcaacttc
atgtttcacgaggatgccaagcgtggtgattcgaaggcgagaaatcgctactctgtatga

DBGET integrated database retrieval system