KEGG   Selaginella moellendorffii: SELMODRAFT_128074Help
Entry
SELMODRAFT_128074 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
smo  Selaginella moellendorffii
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:smo00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    SELMODRAFT_128074
Enzymes [BR:smo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SELMODRAFT_128074
Peptidases [BR:smo01002]
 Metallo Peptidases
  Family M67
   SELMODRAFT_128074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 172 aa AA seqDB search
SSSLMDEFMRMAKSNTSKNIETCGVLAGSLEGGNFFVTALIIPKQQATANTCETIDEEEI
FFAQDKRGLFQLGWIHTHPTQSCFMSSVDVHTHYSYQVMLPEAIAIVMAPQDASKNFGIF
RLSDPGGMNVIQQCSKRGFHGHDPTSDGTPLYHRTSHVYLDPKVKFDVVDLR
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
tcatcttcactgatggacgagtttatgaggatggcgaagtccaacacgtcaaaaaacatt
gagacttgtggggttttagccggctccctggaaggcgggaatttctttgtgactgcactg
atcattccgaagcaacaagcgactgccaatacctgcgagacgatagacgaggaagagatt
ttcttcgctcaagacaagcgtggcctatttcaactgggatggattcacacacatcccacg
caatcctgtttcatgtcatccgtcgacgttcatacacactactcttaccaggtgatgttg
ccagaagcgatagcgatcgtgatggcaccgcaagacgcatccaaaaactttggaattttt
cggctctccgaccctggtggaatgaacgtaatccagcaatgctccaagcgtggcttccat
gggcacgatccaacaagcgatggaacgccactgtaccatagaaccagccatgtatatcta
gaccccaaagtgaaattcgatgttgttgatctgagataa

DBGET integrated database retrieval system