KEGG   Selaginella moellendorffii: SELMODRAFT_128261Help
Entry
SELMODRAFT_128261 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
smo  Selaginella moellendorffii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 369 aa AA seqDB search
MGATGSKLEKALGDQFPEGERYFGLENFGNTCYCNSVLQALYFCVPFRDQLLEYYSRTKS
SGEPEENLLTCLADLFSQINSQKKKTGVIAPKRFVQRVKKQNELFRSYMHQDAHEFLNFL
LNELVETLEKEAKSGRTASGNLKPAEKKENGVANGTAADQDHPLTWVHKIFQGFLTNETR
CLRCETITARDEKFLDLSLDIEQNSSITSCLRNFSSTETLNAEDKFFCDKCCSLQEAQKR
MKIKTPPRILALHLKRFKYIEQLGRYKKLSYRVVFPLELKLCNTTDDAPGSESEYSLFAV
VVHVGSGPNHGHYVSLVKSHSHWLFFDDENVEIIDETYVQTFFGSTQEYSNNTDHGYILF
YECLDAKTT
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgggagcaacgggctccaagctggagaaggcgctgggggaccaattcccagagggggag
aggtattttgggctggaaaactttggcaacacttgctattgcaacagcgttctccaggca
ctgtacttttgtgtcccattccgggatcagctgctagagtactacagccggacgaaatcc
agcggagagccggaagagaatttgctcacttgccttgcagacctcttctcgcagataaac
tcccagaagaagaaaacgggtgttatagctccaaagcgattcgtgcagcgagtgaagaaa
caaaacgagctcttccggagctacatgcaccaggacgcacacgagtttctaaactttttg
ctgaatgaattagttgagactttggagaaggaggccaagtcgggacggacagcctcggga
aatctgaaacctgccgagaaaaaagaaaacggtgtggccaatggaacagcagcagaccaa
gatcatccgctcacttgggttcacaaaatcttccagggattcctcacaaacgagacgagg
tgcttacggtgcgagacgatcacagcgcgggacgagaagtttctcgacttgagcttagac
atcgagcaaaacagctccatcaccagctgccttcgcaacttcagctccaccgagacgctg
aacgccgaggacaagttcttctgcgacaaatgctgcagcttgcaggaggctcaaaagagg
atgaagatcaaaacaccgcctcggatcctcgccctgcacctcaaacgcttcaagtacata
gagcaactgggccgatacaagaaactctcgtacagagtggtctttccgctggagctcaag
ctttgcaacaccaccgacgatgctccaggctccgagtccgagtactcgctgtttgcggtg
gtggttcacgtcggcagcggtccgaatcacggccactatgtcagcctcgtcaagagccac
agccactggctgtttttcgacgacgagaacgtagagatcatcgacgagacgtacgtgcaa
actttctttggatccacgcaggagtactccaacaacacggatcatggttacatcctcttc
tacgagtgcctggacgccaaaactacatga

DBGET integrated database retrieval system