KEGG   Selaginella moellendorffii: SELMODRAFT_129301Help
Entry
SELMODRAFT_129301 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
smo  Selaginella moellendorffii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SELMODRAFT_129301
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SELMODRAFT_129301
Enzymes [BR:smo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SELMODRAFT_129301
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 316 aa AA seqDB search
MLGRKFEVEHVLEAQQFDRELLEGIFGVAKEMEAIVEGRSGGGSTMLKGYLMATLFYEPS
TRTRLSFESAMKRLGGEVLTTENAREFSSAAKGETLEDTIRTVEGYSDIIVMRHFESGAA
KQAAAVSSIPVINAGDGPGQHPTQALLDVYTIQRETGRLDGIKVGLVGDLANGRTVRSLA
YLLAKYDGVKFYFVSPDVVKMKDDIKEYLTSKNIEWEESKDLMEVASKCDVIYQTRIQRE
RFGDKIELYNQARGKYIVDRKVVDVLQSHAVVLHPLPRLDEITTEVDVDPRAAYFRQAKN
GLFIRMALLKLLLLGW
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgctagggcggaagttcgaggtggagcacgtcctcgaggcgcagcaattcgaccgggag
ctgctggaggggatctttggcgtggccaaggagatggaggcgatcgtggaggggagatcc
ggcggcggctccacgatgctcaagggatatctcatggcgacgctgttttacgagccatcg
acgaggacgaggctgtcgtttgagtcggccatgaagcgcctgggtggagaagtgctcacc
acggagaatgctcgcgagttctcgtcggctgccaaaggggagacgctcgaagacacgatc
aggacggtggaaggctactcggatataatcgtgatgagacactttgagagtggagctgcc
aagcaagctgccgctgtgtcgagcatcccagtgatcaatgctggcgatggacctgggcag
catcccacgcaggcactgttagatgtttacacgattcagagagagaccgggcggctcgac
gggatcaaagtcgggctcgttggagaccttgccaacggaagaactgttcgatctctggcc
tacttgctcgccaagtacgatggtgtcaagttctacttcgtctctccagacgtggtgaag
atgaaggatgatatcaaagagtatcttacctccaagaacatagagtgggaagagtcgaag
gatctcatggaagtggcatccaaatgcgatgtcatttaccagacgcgcattcaacgcgag
agatttggcgacaagatcgagctctacaaccaggcccgtggaaaatacattgtggaccgc
aaagtagtggatgtgcttcaaagccatgccgttgttttgcatcctcttcccaggcttgac
gagattaccacagaagtagatgtcgatccaagagctgcgtattttagacaggccaaaaat
ggtcttttcattcgtatggctttgctgaagttgctattgcttgggtggtga

DBGET integrated database retrieval system