KEGG   Selaginella moellendorffii: SELMODRAFT_129301Help
Entry
SELMODRAFT_129301 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
smo  Selaginella moellendorffii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:smo00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:smo00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 316 aa AA seqDB search
MLGRKFEVEHVLEAQQFDRELLEGIFGVAKEMEAIVEGRSGGGSTMLKGYLMATLFYEPS
TRTRLSFESAMKRLGGEVLTTENAREFSSAAKGETLEDTIRTVEGYSDIIVMRHFESGAA
KQAAAVSSIPVINAGDGPGQHPTQALLDVYTIQRETGRLDGIKVGLVGDLANGRTVRSLA
YLLAKYDGVKFYFVSPDVVKMKDDIKEYLTSKNIEWEESKDLMEVASKCDVIYQTRIQRE
RFGDKIELYNQARGKYIVDRKVVDVLQSHAVVLHPLPRLDEITTEVDVDPRAAYFRQAKN
GLFIRMALLKLLLLGW
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgctagggcggaagttcgaggtggagcacgtcctcgaggcgcagcaattcgaccgggag
ctgctggaggggatctttggcgtggccaaggagatggaggcgatcgtggaggggagatcc
ggcggcggctccacgatgctcaagggatatctcatggcgacgctgttttacgagccatcg
acgaggacgaggctgtcgtttgagtcggccatgaagcgcctgggtggagaagtgctcacc
acggagaatgctcgcgagttctcgtcggctgccaaaggggagacgctcgaagacacgatc
aggacggtggaaggctactcggatataatcgtgatgagacactttgagagtggagctgcc
aagcaagctgccgctgtgtcgagcatcccagtgatcaatgctggcgatggacctgggcag
catcccacgcaggcactgttagatgtttacacgattcagagagagaccgggcggctcgac
gggatcaaagtcgggctcgttggagaccttgccaacggaagaactgttcgatctctggcc
tacttgctcgccaagtacgatggtgtcaagttctacttcgtctctccagacgtggtgaag
atgaaggatgatatcaaagagtatcttacctccaagaacatagagtgggaagagtcgaag
gatctcatggaagtggcatccaaatgcgatgtcatttaccagacgcgcattcaacgcgag
agatttggcgacaagatcgagctctacaaccaggcccgtggaaaatacattgtggaccgc
aaagtagtggatgtgcttcaaagccatgccgttgttttgcatcctcttcccaggcttgac
gagattaccacagaagtagatgtcgatccaagagctgcgtattttagacaggccaaaaat
ggtcttttcattcgtatggctttgctgaagttgctattgcttgggtggtga

DBGET integrated database retrieval system