KEGG   Selaginella moellendorffii: SELMODRAFT_129632Help
Entry
SELMODRAFT_129632 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
smo  Selaginella moellendorffii
Pathway
smo00500  Starch and sucrose metabolism
smo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SELMODRAFT_129632
Enzymes [BR:smo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SELMODRAFT_129632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase BUD22 Cwf_Cwc_15 NOA36 Nop14 DUF3295 CobT
Motif
Other DBs
NCBI-GeneID: 9650429
NCBI-ProteinID: XP_002989346
JGI: 129632
UniProt: D8T135
Position
Unknown
AA seq 557 aa AA seqDB search
MVFSFRSIDRFFFQGFNWESQAKKPWYDTLKSRAAEIQAAGFTDVWFPPPSQSVDKHGYL
PTQLYDLNSSSYGNEAQLRECIDVLHSHNLCCIADIVINHRSGWKQDSTGHWNLYEGGTK
DKRLDWGPWALVSNDIYDSGGKGSKDSGESYGAAPDLDHSNKQVQDELTDWMNWMKAEIG
FDGWRFDFVKGYSPAYTKIYCERTHPSFSVGEYWTSLNYENGRAAANQNTHRQQLCDWID
GTGGLSCVFDFTTKGVLQDAVKNEYWRLRDGEGKPPGLIAGWYPTKAVTFVDNHDTGSTQ
RHWNFPDDKVLLGYVYIITHPGIPCIFWDHFFDWGMKDKISQLMELRRNNGIHSDSKITI
LAADFDMYVACVDERLIIKLGNRFDMGTLVPNPTAWKIIMTGPEFAIWENMKEHAILPQP
KLTSDIVINAAGGSAADATKTDVEIKITTDMSCGTVGRIMQEVPGLVSNAKDLSDTLKSC
KLPPPSGIDNSKNKDTDKSKPAAVKQKVEIHDEDNEVDEDDEDDDDDDEDDDEDDEDDDD
NDDDDEDERENVKNKKK
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggtttttagttttcgaagcattgatcgtttcttcttccagggattcaactgggaatct
caagcaaagaagccttggtatgacactctcaagagcagggctgcggagatccaagctgcc
ggcttcacagatgtgtggtttccaccaccttcacagtcggttgataagcatggatatttg
ccgactcagctctacgatcttaactcgtcgagctacgggaatgaggcccagctgagggaa
tgcatcgacgtcttgcattcgcataacctgtgctgcatcgccgacatcgtgatcaaccat
cgaagtggctggaagcaagactcaactggacactggaacctttacgagggtggaaccaag
gacaagaggcttgactggggaccgtgggctttggtcagcaacgacatctatgacagtggt
gggaaggggtccaaggatagtggtgagagctatggagcggctccggacctggaccattcc
aacaagcaagtgcaagacgagctcacagactggatgaactggatgaaggcagagattgga
ttcgatggttggcgcttcgatttcgtcaagggctactcaccggcctacaccaagatatac
tgcgagagaacacatccaagcttctcggtgggcgagtactggacttcgttgaactacgaa
aacggcagggcggctgcaaaccaaaatacccacaggcaacagctttgcgattggattgat
gggactggaggactttcctgtgtgttcgacttcaccaccaaaggagttcttcaagatgcc
gtgaagaacgagtactggcgactgcgggacggagaggggaagcctcccggtcttattgca
gggtggtatccaacaaaagctgtaacgtttgtcgacaatcacgacacgggatctactcag
agacactggaattttcccgatgacaaagttctcttgggctacgtatacatcatcacgcat
ccaggcataccatgcattttctgggaccatttcttcgactgggggatgaaggacaagatc
tcacaactgatggagctgagacgaaacaacggcatacactcagacagcaagatcacgatt
cttgcagcggacttcgacatgtacgttgcctgtgtcgacgaaaggctcatcatcaagctc
ggaaacaggtttgacatgggcacgctcgtcccaaatcccacagcgtggaagatcatcatg
accggaccagagttcgccatctgggagaacatgaaagagcatgccatccttccacagcca
aagctcacgtccgatattgtcatcaacgcggctggtggcagtgcggcagatgccaccaag
acagacgtggagatcaaaatcaccaccgacatgtcgtgtggaaccgtgggccggataatg
caggaggtgcccggcctcgtctcaaacgcaaaggacttgagcgacaccttgaagagctgc
aagctcccgcctcccagcgggattgacaacagcaagaacaaggacacggacaagagcaag
ccagcagcagtgaagcaaaaagtggagatccatgacgaagacaatgaggtcgatgaagat
gatgaggacgacgatgacgatgatgaagacgatgatgaagatgatgaagatgacgatgac
aatgacgatgacgacgaagacgagcgtgagaatgttaaaaacaagaagaaatga

DBGET integrated database retrieval system