KEGG   Selaginella moellendorffii: SELMODRAFT_131200Help
Entry
SELMODRAFT_131200 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
smo  Selaginella moellendorffii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 212 aa AA seqDB search
MGCFHSKPSQHAAGYEDPVALASDTTFSVSEIEALYELFKKISSSVIDDGLIHKEEFRLA
LFKNSKKENLFADRVFDLFDVKRNGVIDFGEFVRSLSVFHPNAPLEDKIDFAFQLYDLRR
TGFIEREEVKQMLIALLSESDMKLSDDVIETILDKTFAEADTNNDSRIDKEEWQNFVLRN
PSLMKNMTLPYLKDITTAFPSFVFNSEVEDVA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcttccactcgaagccctcgcagcacgcggccgggtacgaagatcctgtagct
ctggccagtgataccaccttcagcgtgagtgagatcgaagcgctgtatgagctcttcaag
aagatcagcagctccgtcattgacgatggcctcatccacaaggaggaattccgcttggcg
ctcttcaagaacagcaagaaggagaacttgttcgcagatcgggtgtttgaccttttcgat
gtgaagagaaacggggtgatcgatttcggggagttcgtgcgctccctcagcgtgttccac
cccaatgcaccgctggaagacaagatcgactttgccttccagctgtatgatctgcgcagg
accggtttcatcgaacgagaagaggtgaagcagatgctaatcgccttgttatcagagtcg
gatatgaagctctccgacgacgtcatcgaaactattcttgataagacgtttgcggaagcc
gacaccaacaacgacagtcgaattgacaaggaggagtggcagaacttcgtgctgaggaat
ccttcgctcatgaagaacatgacgctgccgtacctcaaagatatcacgacagcattcccg
agctttgtattcaattcggaagttgaagacgttgcgtga

DBGET integrated database retrieval system