KEGG   Selaginella moellendorffii: SELMODRAFT_131541Help
Entry
SELMODRAFT_131541 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
smo  Selaginella moellendorffii
Brite
Enzymes [BR:smo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     SELMODRAFT_131541
Protein phosphatases and associated proteins [BR:smo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SELMODRAFT_131541
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 630 aa AA seqDB search
RAMAVGVVYDRRMCAHRDPFNKLHPEQPARITAIWQRLEDAGVLDRCVRVDARPATAEEL
ATVHTERHIEKMSSVSSRAYGKEGRAALARRYNSIYFNDGSSESALLAAGSVVELSLKVA
RGELASAAAIVRPPGHHAEADEAMGFCLFNNVAVAAQILSSGKVSVAGSHKVLIVDWDVH
HGNGTQNMFWQDPNVLYFSVHRYDDGYFYPGGQEGNFDKVGGGAGAGFNINVPWPRGGYS
DADYVAVWEHVLMPVAREFNPDIVLISGGFDSARGDPLGGCKLTPLGYSIMTQELMQLAG
GKIVLALEGGYNLESIAESYLACVQVLLGDIQSERHEIEQAYESTWTTIDKVRQELCQYW
PVLREKIEMPASRSSPPKAFERLTTEADAVEETHDGEVFVRSETVEIVQISVSSEVSSPH
SPSPYIWYATYGSNMWPARLMCYIQGGKVEGIEVPGQGLLEKTPPLEDFWLSAPHRLFFG
RERSLSWGNGGVAFLNPVPSDGDNCHLRAYKITLEQFNGILAQENRLDSVAASGLVSPSH
FETLKSSPHIVDFIENAWYGSVLYLGDKNGAPILTITCSQRDAKRFECGELPTRAPSVAY
QNTLINGLLEKGDMSHEQILAYVTSRAPRS
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
agagcaatggcggtgggagtggtgtatgatcggcgaatgtgcgcgcaccgcgatcctttc
aacaagctccatccagagcagccggcgaggattacagcgatctggcagcgcctcgaggat
gcaggcgtcttggacaggtgcgtgcgagtggacgcgaggccagcgacggcggaagagctc
gcgacagtccacacggagaggcacatcgagaagatgtcgtccgtgagcagcagagcttat
gggaaagaaggacgagcagctctcgcgaggcgctacaactcgatatatttcaacgatggc
tcgtcggaatcggcacttctagctgccggatccgtcgtggagctctctctcaaagttgct
cgaggagagctcgcgtccgccgctgctatagtgagaccacccgggcaccacgctgaagcg
gatgaagctatgggattctgcctatttaacaacgttgctgtagcagctcaaattctttca
tcgggaaaagtgagtgtggcggggtcgcacaaagtcttgatcgttgattgggatgttcac
catggaaatggaacccaaaacatgttttggcaagatcccaacgttttatacttctctgtc
cacagatatgacgatggatacttctaccctggaggtcaggaagggaatttcgataaagtt
ggaggaggtgccggtgcggggtttaatatcaatgtcccgtggcctcgtggtggatatagc
gacgcggattatgtcgctgtttgggagcacgtattgatgccagtggccagggagttcaat
cctgacatagttcttatatcgggaggttttgattcagctcgaggagatccgttgggtggc
tgtaagcttacaccactaggttactcgatcatgacacaggaacttatgcaactggctgga
ggaaaaattgttctagctcttgagggaggctacaaccttgagtcgattgctgaatcgtat
ttggcatgcgttcaagttctacttggagatattcaaagtgagcgccacgagattgagcaa
gcttacgagtctacatggactaccattgacaaggtccgacaggagctgtgtcaatactgg
cctgttctgcgtgaaaagatcgaaatgccggcttccagatcctctcctcccaaggctttc
gaaaggcttactaccgaggctgatgcagtcgaagaaacacacgatggtgaggtttttgtt
cgctcagaaactgtggagattgtccagatatccgtgagttctgaggtctctagtcctcac
agcccgagtccatacatatggtacgcaacttatggctctaatatgtggccagctcggttg
atgtgctacatccaaggtggcaaggtcgaaggtattgaagtgccaggacaaggtctactt
gaaaaaactccgccgctggaagacttttggctgtcagctccacatcgactattttttgga
cgagagagatctctttcgtggggcaatggaggcgttgcgttcctgaatccagtgccatct
gatggcgacaattgccatctccgagcatacaaaataacgctagaacagttcaatggtata
ctcgctcaagagaacaggctcgactcagtggcagctagcggcttggtttctccatcccac
tttgagacgctgaaaagttcacctcatattgtggacttcattgagaacgcgtggtatggc
agcgtcttatatcttggcgacaaaaatggagcgccgattctcacaatcacgtgctcgcaa
agagatgcaaaacgtttcgagtgtggggagcttcccacccgggctccttcggtggcgtat
caaaacactttaatcaatggcctacttgaaaagggagatatgtcgcacgagcaaatcctc
gcgtacgtgacgtctcgagcaccaaggagctaa

DBGET integrated database retrieval system