KEGG   Selaginella moellendorffii: SELMODRAFT_132835Help
Entry
SELMODRAFT_132835 CDS       T01496                                 

Gene name
DET2A-1
Definition
(RefSeq) hypothetical protein
  KO
K09591  steroid 5-alpha-reductase [EC:1.3.1.22]
Organism
smo  Selaginella moellendorffii
Pathway
smo00905  Brassinosteroid biosynthesis
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    SELMODRAFT_132835 (DET2A-1)
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     SELMODRAFT_132835 (DET2A-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Steroid_dh PEMT DUF1295 ERG4_ERG24
Motif
Other DBs
NCBI-GeneID: 9633761
NCBI-ProteinID: XP_002991096
JGI: 132835
UniProt: D8T630
Position
Unknown
AA seq 261 aa AA seqDB search
MEEEQWYWKALWLNIILAFSTAASLTRITAPYGRHTQAAPSSSLDVWGPSMPARDGWVLM
ESPALWFTLLVFSAGKHSSETVPLVLLRLFQLHYTHRALIYPFRMRSRGKTISIAIVALS
FVFNIYNGYLQARWLSEFGTYPDTWLRSPQFISGSLLFAAGMVTNVWADSVLISLRKPGE
ERGGYKLPQGWLFSLVACPNYSGEILEWLGWALLTWSPAGLVFFIFTAANLIPRAVAHRR
WYVSKFPEFPASRRAVIPFVL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagagcagtggtactggaaggcgctctggctgaacatcatcttagctttctcc
accgctgcgtcgctgacgagaatcacagcaccatacggtcgccacactcaagcagcaccg
tcttcttccttggacgtctgggggccgagcatgccagcccgagatggatgggttctcatg
gaaagcccggctctctggttcactctcctcgtcttctcggccgggaagcactccagcgaa
accgtcccgctcgtcctcctccgacttttccagctccactacacgcacagggctctcatc
tatccgtttcgcatgcgctcaaggggcaagacgatctccatcgccatcgtcgctctctcc
ttcgtcttcaacatctacaacggatatctccaggcgcggtggctgtccgagtttggaact
tatcccgacacttggctccggagtccgcagttcatctctggaagcttgctctttgcggcc
gggatggtgaccaacgtctgggccgactcggttcttatttccttgcgcaagcccggcgag
gagcgagggggatataagttgccacaggggtggctcttctcgctcgttgcatgcccgaat
tactccggagagatcctcgagtggctcggctgggctcttctcacttggtcccccgccggc
ctcgtcttcttcatcttcacagccgcgaatctcatcccgcgagctgtggctcaccgccgc
tggtatgtttcaaagtttccggagtttccagcctctcggcgagcagtgatcccgttcgtt
ctctaa

DBGET integrated database retrieval system