KEGG   Selaginella moellendorffii: SELMODRAFT_137786Help
Entry
SELMODRAFT_137786 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K05575  
NAD(P)H-quinone oxidoreductase subunit 4 [EC:1.6.5.3]
Organism
smo  Selaginella moellendorffii
Pathway
Oxidative phosphorylation
Metabolic pathways
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:smo00190]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
MT
AA seq 524 aa AA seqDB search
MTSNYPWPTIIVPLPVPAGLLIPPLPPPKGGNKIVRRYTLGIRSPEFPPITHTLCYHFES
KSPFVQSREDYDWINIPPDFHWRLGIDGLTMGLIPPTGFVTTSATPAARPVTRSPRSFYP
SMLAMHSGQVGSFASQDILPPFLVWEPELIPAHSLLRSWGGKRRSYAATKSIPYTAAGGP
ISLLSGAITMGLYMPGEPALDFRVPADRSHPAALEMVSYLSFPIAYAIKPPILPSHARSP
DTHGEAHYSTRMLPAGASSKMGGYGPLRINMESSPSAHSIFAPGLAVVGAIQIVCAASIS
PNQRSVKRRIAHPPVSHTGFVPIGIGPITEIGPEGAILQMISHGLIGAALSPIGGAGCDR
MQTPFLGRMGGIAIPMPKIFILFSSLPIASLALPGMSGSAAESMVSPGIAGSTNRSYDSK
IIVLVTAAIGIILTPIHPLSMPRQMPYGYSGVTPAVPRVMDYGPREIFIPIRPLLPVIGI
GLYPNAVLSLCQSGIYPISISPEQTAIYPFHSFPPAANKIIVDQ
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcaactatccctggccaacaataatcgttcccctgcccgtgcctgcgggtctg
ctaatcccaccattacccccacctaaaggtggaaacaagattgttcgccggtacactctg
ggaattcgctcgccagagttccccccgataacccacacactttgctaccacttcgagtcc
aaaagcccattcgttcaatcgagagaggattatgactggatcaatatcccccccgatttc
cactggagactggggattgatggacttaccatggggcttattccaccgacaggatttgtt
actacgtcagctactccagcagctcggcctgttacccgaagtccgcgatcattctatccc
tcgatgctagcgatgcacagtggtcaggtaggatcattcgcttctcaagacatcctgccc
ccctttcttgtgtgggagccggaattaattcctgctcattcgctgctgcgttcgtggggg
gggaagagacgttcatacgcagccacgaaatctattccgtacaccgcggcgggtggtccc
atatctctcttatcaggggctatcaccatgggtctttacatgccaggcgaaccagcatta
gatttccgggttccggctgatagatcccatcccgcggcattggaaatggtctcataccta
agctttcccatagcctatgccattaaaccaccaattcttccctcgcacgcccggtcgccg
gatacccacggggaagcacattatagtacacgcatgcttccagctggagcatcgtcgaag
atgggagggtatgggccactcaggattaatatggaatcatctcctagcgctcactccata
tttgcccctggattggcagtggtaggagcaattcagattgtttgtgcggcttcgatatcc
ccgaatcaacgtagtgtgaagagaagaatcgctcacccaccagtatctcatacgggtttc
gtacccatcggaataggtcccataacagagataggccccgaaggagcaattttacaaatg
atttctcatggattgattggtgctgcactttcccccattgggggggcgggttgcgataga
atgcaaaccccttttctcggccggatgggcgggatagctattcctatgcccaaaatattc
atcctgttcagtagcctcccaattgcatctctcgcactgccgggcatgagtggttccgca
gcggaatcaatggtttctccggggatagccggtagtacaaatcgttcctacgactcaaaa
ataatcgttcttgtgacggcagcgattggaataatattgactcccatacacccgctatcc
atgccacgtcaaatgccttatgggtacagcggggttaccccagcagtccctcgcgtcatg
gattatggaccacgagagattttcattccgattcgtccactgttgcccgtcataggcatt
ggcctttatccaaacgcggtcctttctctgtgccagagcggaatttacccgatctcgata
tccccggagcaaacggcaatttatccgtttcattcatttcctccggcagcaaataaaata
atagtggatcagtaa

DBGET integrated database retrieval system