KEGG   Selaginella moellendorffii: SELMODRAFT_137956Help
Entry
SELMODRAFT_137956 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
smo  Selaginella moellendorffii
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:smo00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 111 aa AA seqDB search
MATFKDAPAGNAASGEKLFKTKCSACHTIEKGGGHKQGPNLNGVVGRVSGTAPGFSFSQA
NRNAKVTWKDDTLYDYLLNPKKFMPGNKMVFPGLKKPQDRADLIAYLKKSG
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggcaacttttaaggatgccccagccgggaatgcagcgagtggagaaaagctgtttaag
accaaatgttctgcttgtcacacgattgagaaggggggtggccacaaacaaggcccaaat
ctcaacggagttgttggacgagtttctgggacagctcctggtttttctttctctcaggca
aacaggaatgctaaggttacctggaaggatgatacgttatatgactatcttttgaatccc
aagaagtttatgccagggaacaagatggtttttcctggattaaagaaacctcaagacagg
gccgatttaatagcatacttaaagaaatcgggataa

DBGET integrated database retrieval system